Dataset for protein BCL-2-like of organism Ovis aries

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   . . :        
-------------------------p------tpasspstrelvv----------------------dflgyklrqkgy-
mgwpnlkylllglspyihasllcrt-taarmm---maqdvharaappeafaafpiygmqikrqqqwfkyvsfv--pr--s
                     gslp rrgpgavdtlteynar lq                       wfk crsiqvrp
                      g k gp gapa pfrdr  k  m                       m e  fqaa   
                                   ef p  c  e                             f     
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           .       :  .         
---------------------------------------------------------vvgsgtghspsldt---------
wsqfsdveenrtetsegtesdmetpsaisgnpswhlaleiisqylleqatgtkddspqpngap-egraaeprkvipmavv
lplmvgmas nspgpd slpstpp  eenedelyrqs                 ak lc a-at-rstptagem    al
      e      al             e                            eg tp-pspk s         
                                                         a      ak              
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :. ..          .     .              .:      .   .*** .::. * . :              
-qalreagdevetryrrtfsdltsqlhvtp-gtayqsftqvsdelfqdgv-nWGRivaffsFggalckesvnkemevlvs
k-vmqavassfqlefetavqqmlrkydivsvesvqtrlerlmn---egppvs   latlvv easvtak---ttsqpkrg
hr-  r snrcl-nvqqnllpcaarfrrkr dldvrmas  vvkv s  it    v siit a i lvrqpvlnrrsiie
 a   h  ag  r hn   kg yd    hn  k rki q  lehe r  gp    n    a   f amhlksilqkrcad
     d      d a                 d a   n  i                         e  iq    q   
                                                                       d        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :    .         *:  . .*                                              
q----------vaewmatylethladWiqsnggW----------------------------------------------
dmsvsrdcrlliqtsvvafinrrtep lhesrd eleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsi
rgdmck     ltylitqvcvdsrr-  vqq                                                 
p           slfc e  tknkge  rk                                                  
                 d          ma                                                  
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----dgfvely------------------gngav-esrrlqe-------------------------------------
eekmea-----fvgnvdygataeeleahfh--n-at--ekgsdkfsghpkgfayiefsnwesvrtvltldeslfrgrqik
     etatss-                  sh-t-psw-tvrv              gdka    s a            
      i rli                   edssqnrvtiqlg                                     
      e caf                    c llkkfq ke                                      
      d                          f e a   c                                      
                                   a                                            

       410       420       430       440       450       460   
....:....|....:....|....:....|....:....|....:....|....:....|...
                                     :                         
----------------wfnrw-ltamtvag-vllgryfsik----------------------
vipkrtnrpgisttlrgl---y-rgvit--v-g--lly---nsrprgrvyrgraratswyspy
              de--tlsvyldralvyns-sssf wrsl                     
                rgpfnswg k istmesrkqa ngr                      
                h i lrv  i gnllcra i  lef                      
                  f af   f ceaga      ac                       
                     e        a                                
© 1998-2022Legal notice