Dataset for protein BCL-2-like of organism Ovis aries

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


W5Q0N6_BCL2A1-01       -------------------------------MTDTEFDYVHKLAE-----
W5QIG4_BCL2L10-01      ----------------------GRPPGRGGAMVDPFRERTARLLM-----
W5QI41_MCL1-01         ---------------------GSRKPRPAPGPAPALTPPVRCRAQPPEAF
Q9MZS7_BCL2L1-01       -----------------------------------MSQSNRELVV-----
W5PSA5_BCL2L1-01       -----------------------------------MSQSNRELVV-----
W5QDH4_BCL2L2-02       MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVA-----
W5QDH4_BCL2L2-01       MGWPNLKYLLLGLSPYIHASLLCLTPTAARMATPASAPDTRALVA-----
                                                                         

W5Q0N6_BCL2A1-01       -----------------DYLKYVLQIQ-----------------------
W5QIG4_BCL2L10-01      -----------------DWLEFC--AR-----------------------
W5QI41_MCL1-01         AAFPIYGMQIKRQQQWFKMFGFKRRPAVRPLPLMVGEASNNSPGSDGSLP
Q9MZS7_BCL2L1-01       -----------------DFLSYKLSQKGYSWSQFSDVEENRTEAPEGTES
W5PSA5_BCL2L1-01       -----------------DFLSYKFFQKGYSWSQFSDMEENRTETLEGTES
W5QDH4_BCL2L2-02       -----------------DFVGYKLRQKGY---------------------
W5QDH4_BCL2L2-01       -----------------DFVGYKLRQKGY---------------------
                                        . . :                            

W5Q0N6_BCL2A1-01       -------------------------------------QPGS----KPSKT
W5QIG4_BCL2L10-01      -------------------------------------EPGTPAPAPSTPE
W5QI41_MCL1-01         STPPPSEEEEDELYRQSLEIISQYLLEQATGTKDAKPLGGSGATSRKALE
Q9MZS7_BCL2L1-01       DMETPSAINGNPSWHLA-----------------DSPAVNGATGHSRSLD
W5PSA5_BCL2L1-01       DMETPSAISGNPSWHLA-----------------DSPVVNGATGHSRSLD
W5QDH4_BCL2L2-02       -------------------------------------VCGAGPGEGPAAD
W5QDH4_BCL2L2-01       -------------------------------------VCGAGPGEGPAAD
                                                              .       :  

W5Q0N6_BCL2A1-01       S----------RVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQ
W5QIG4_BCL2L10-01      A----------AVLRHVAARVL-EANRNVLPLYRRYRRHRVELVARMAQR
W5QI41_MCL1-01         T------------LRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSR
Q9MZS7_BCL2L1-01       AREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQ
W5PSA5_BCL2L1-01       TGKMIPMAVVKQALREASNECELRYQQTFSDLTSQLHITP-GKAYQSFEQ
W5QDH4_BCL2L2-02       P--------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQ
W5QDH4_BCL2L2-01       P--------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQ
                       .            :. ..          .     .              .

W5Q0N6_BCL2A1-01       VMEKEFEDGIVNWGRIVTIFAFEGILTKK---LLSKRIASDMDMCKD---
W5QIG4_BCL2L10-01      LLD---EDPGPSWGRVASLVTFAGSLLERQPQTTRRQKRDDGSVSRDCRL
W5QI41_MCL1-01         VMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEP---------
Q9MZS7_BCL2L1-01       VVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVSR---------
W5PSA5_BCL2L1-01       VINELFQDGV-NWGRNVAFFSFGGALCMKSIVKEMQVLVSQ---------
W5QDH4_BCL2L2-02       VSDELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVGQ---------
W5QDH4_BCL2L2-01       VSDELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVGQ---------
                       :      .   .*** .::. * . :                        

W5Q0N6_BCL2A1-01       -ISYFVAEFITKNTGEWIRQNGGW--------------------------
W5QIG4_BCL2L10-01      LVALLCAQFCERHRA-WLMANGGW--------------------------
W5QI41_MCL1-01         -LAESITDVLVRSKRDWIVKQRGW--------------------------
Q9MZS7_BCL2L1-01       -IATWMATYLNDHLEPWIQENGGW--------------------------
W5PSA5_BCL2L1-01       -VTTWMATYLNDHLEPWIQENGDW--------------------------
W5QDH4_BCL2L2-02       -VQEWMVAYLETRLADWIHSSGGW--------------------------
W5QDH4_BCL2L2-01       -VQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEV
                        :    .         *:  . .*                          

W5Q0N6_BCL2A1-01       -------------------------E------------------------
W5QIG4_BCL2L10-01      -------------------------DGFCLSF------------------
W5QI41_MCL1-01         -------------------------DGFVEFF------------------
Q9MZS7_BCL2L1-01       -------------------------DTFVELY------------------
W5PSA5_BCL2L1-01       -------------------------DIFVELY------------------
W5QDH4_BCL2L2-02       -------------------------AEFTALY------------------
W5QDH4_BCL2L2-01       EKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFH
                                                                         

W5Q0N6_BCL2A1-01       -NGFVKKFETKSG-------------------------------------
W5QIG4_BCL2L10-01      SHSLQPSWERQLV-------------------------------------
W5QI41_MCL1-01         ---------RVED-------------------------------------
Q9MZS7_BCL2L1-01       GNNAAAESRKGQE-------------------------------------
W5PSA5_BCL2L1-01       ENNTATESQKGQE-------------------------------------
W5QDH4_BCL2L2-02       GDGALEEARRLRE--------------GNWASVRTVLT------------
W5QDH4_BCL2L2-01       GCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIK
                                                                         

W5Q0N6_BCL2A1-01       ----------------WLTFLEVTGKICETLCRLKQYY------------
W5QIG4_BCL2L10-01      ----------------WFFLSYWTAIII-------IYFWIKLS-------
W5QI41_MCL1-01         --------------LEGGIRNVLLAFAGVAGVGAGLAYLIR---------
Q9MZS7_BCL2L1-01       ----------------RFNRWFLTGMTVAGVVLLGSLFSRK---------
W5PSA5_BCL2L1-01       ----------------HLNRWSLTDMTVAGMALLGLLFNCK---------
W5QDH4_BCL2L2-02       -----------------------GAVALSLAEGSGRFFAES---------
W5QDH4_BCL2L2-01       VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
                                                            :            

W5Q0N6_BCL2A1-01       -------------
W5QIG4_BCL2L10-01      -------------
W5QI41_MCL1-01         -------------
Q9MZS7_BCL2L1-01       -------------
W5PSA5_BCL2L1-01       -------------
W5QDH4_BCL2L2-02       -------------
W5QDH4_BCL2L2-01       RGRARATSWYSPY
                                    

© 1998-2022Legal notice