Dataset for protein Bcl-2 of organism Oryctolagus cuniculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAARTSPPPPPAAAGPALSPVPPVV
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
HLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNI
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************                              : ..**... * .  .*.*         
ALWMTEYLNRHLHTWIQDNGGW-----------------------------tssvsLYspsvR-pwsgFsW---------
                      adkspwisgclctsrratpgahsltegsadafae  gaqh ealhd c nekigraal

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 : *.*:::::*.                                                   
----------------vslKvLislsvIg---------------------------------------------------
dnstakhcgrrfglhtkaa t fafal akkalnsslhvfrmtdfcsassehsashgkerldlrgktqktddgsqlvlqk

       330       340       350       360       370       380         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
  .   :*:  *:*                                                       
--pvntlGtylGqK-------------------------------------------------------
efacicf ave h qskdvlpciyiiyeafshlevllyvlqwdlascqlqfepisfcigfcvqgnlvsl
© 1998-2020Legal notice