Dataset for protein Bcl-2 of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F9CRQ4_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAP
A0A5F9CRQ4_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAP
                        **************************************************

A0A5F9CRQ4_BCL2-02      AAPRDPAARTSPPPPPAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFA
A0A5F9CRQ4_BCL2-01      AAPRDPAARTSPPPPPAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFA
                        **************************************************

A0A5F9CRQ4_BCL2-02      EMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
A0A5F9CRQ4_BCL2-01      EMSSQLHLTPFHARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
                        **************************************************

A0A5F9CRQ4_BCL2-02      REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWADKSPWISGCLCTSRRAT
A0A5F9CRQ4_BCL2-01      REMSPLVDNIALWMTEYLNRHLHTWIQDNGGW------------------
                        ********************************                  

A0A5F9CRQ4_BCL2-02      PGAHSLTEGSATSSASLYSAQHREAWHGFCWNEKIGRAALDNSTAKHCGR
A0A5F9CRQ4_BCL2-01      -----------DAFVELYGPSVR-PLSDFSW-------------------
                                    : ..**... * .  .*.*                   

A0A5F9CRQ4_BCL2-02      RFGLHTKAAKVLIAFSVIAKKALNSSLHVFRMTDFCSASSEHSASHGKER
A0A5F9CRQ4_BCL2-01      ------VSLKTLFSLALIG-------------------------------
                               : *.*:::::*.                               

A0A5F9CRQ4_BCL2-02      LDLRGKTQKTDDGSQLVLQKEFPVNCFGTVEGQKQSKDVLPCIYIIYEAF
A0A5F9CRQ4_BCL2-01      ----------------------ACITLGAYLGHK----------------
                                              .   :*:  *:*                

A0A5F9CRQ4_BCL2-02      SHLEVLLYVLQWDLASCQLQFEPISFCIGFCVQGNLVSL
A0A5F9CRQ4_BCL2-01      ---------------------------------------
                                                               

© 1998-2022Legal notice