Dataset for protein Bcl-2 of organism Oryctolagus cuniculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1TW27_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAART
G1TW27_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAART
                    ************************************************************

G1TW27_BCL2-02      SPPPPPAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATV
G1TW27_BCL2-01      SPPPPPAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFHARGRFATV
                    ************************************************************

G1TW27_BCL2-02      VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNG
G1TW27_BCL2-01      VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNG
                    ************************************************************

G1TW27_BCL2-02      GWADKSPWISGCLCTSRRATPGAHSLTEGSATSSASLYSAQHREAWHGFCWNEKIGRAAL
G1TW27_BCL2-01      GW-----------------------------DAFVELYGPSVR-PLSDFSW---------
                    **                              : ..**... * .  .*.*         

G1TW27_BCL2-02      DNSTAKHCGRRFGLHTKAAKVLIAFSVIAKKALNSSLHVFRMTDFCSASSEHSASHGKER
G1TW27_BCL2-01      ----------------VSLKTLFSLALIG-------------------------------
                                     : *.*:::::*.                               

G1TW27_BCL2-02      LDLRGKTQKTDDGSQLVLQKEFPVNCFGTVEGQKQSKDVLPCIYIIYEAFSHLEVLLYVL
G1TW27_BCL2-01      ----------------------ACITLGAYLGHK--------------------------
                                          .   :*:  *:*                          

G1TW27_BCL2-02      QWDLASCQLQFEPISFCIGFCVQGNLVSL
G1TW27_BCL2-01      -----------------------------
                                                 

© 1998-2020Legal notice