Dataset for protein BCL-2-like of organism Ornithorhynchus anatinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mlglqknaviglnlycggagsgagasppggrlrpdkaaavgegpaaaaaaaarraggggeaaapligggagaspsaaagl
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gvarpapigaegpdvigtlaparrappegteppppsaaaaaaallrpedeldgyepeapakrpahlavldlpgqaggslp
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     *   ::                                              .:  . .
----------madglyrqsreLvtdylryqlaqrkd--------------------------eprgrdrrllrtlrrvgd
stpppddrdd----vvwsvla irhfvsekargpgldwsrlvdpeapdtgaegaeggrgagtvesrtsqaarevmfsaqg
       matpdpasssrtyd al   gdv qtkrh                    aca ppgagppaepvqna  e   
              mfldn    a   d       f                         aa edd    h    a   
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .:     .*..                                                                    
gierrhrtaFsgl------------------------------------------------------------------a
efqvnyerc qdmgglrrmreagaplppppsyvlsalpepngtpppppvpsprrhapqaghpegggpegrvprrhprfq-
dv salkp  dse    kl                                                            r
   k f                                                                         d
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           . . .:    :                                . **:  ::  *.             
-q-hitpgtayqsftqvvtelfed---------------------------g-vnwGRivtifvfGgal--es-vkemlp
w-l--svhsdrrrvsrlsnqvlrghqpgglhrppgrehhggpgdhqeglagqttrl  vcaflsr ai-cv--vrashvr
vgdevqker qkl r irgke qe                            ip    l glipl  hgrtrplqrpggk
sd dlg ae lhi g  geha n                              e           f  qkken kae 
r       a a a e   d                                                   a  ad     

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   .     *.                                     
lvgqvg------------d----wmaeyldttlrdwirsngGwet-fvelygvgav------------w--------vrv
strrtrsrlglsnkmmggsppsssivavtvrskgsrpvqsk hpsgelskfpqktmiysrrrrerqnw-svvrtvgttmq
rinepqci          pelpepsttqrthrhdp lapqa  dn  tnflhpesleqeaqlqaafgrhrslpsilssgn
 g  e             e iacf d f l qaae   kg   ag   a  enddfada kdp    n lqaadg pgal
                               h      d     e       d  a             al   e  a k

       490       500
....:....|....:....|
       :  :         
-lgalvglgsfgagk-----
v----stvkwlf---aylir
tvlvvll aq ytsy     
i alfeh  a  drl     
a    a              
© 1998-2022Legal notice