Dataset for protein BCL-2-like of organism Ornithorhynchus anatinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I8NSR7_MCL1-02      MLGLQKNAVIGLNLYCGGAGSGAGASPPGGRLRPDKAAAVGEGPAAAAAA
A0A6I8NSR7_MCL1-01      MLGLQKNAVIGLNLYCGGAGSGAGASPPGGRLRPDKAAAVGEGPAAAAAA
A0A6I8PIR3_BCL2L1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
                                                                          

A0A6I8NSR7_MCL1-02      AARRAGGGGEAAAPLIGGGAGASPSAAAGLGVARPAPIGAEGPDVIGTLA
A0A6I8NSR7_MCL1-01      AARRAGGGGEAAAPLIGGGAGASPSAAAGLGVARPAPIGAEGPDVIGTLA
A0A6I8PIR3_BCL2L1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
                                                                          

A0A6I8NSR7_MCL1-02      PARRAPPEGTEPPPPSAAAAAAALLRPEDELDGYEPEAPAKRPAHLAVLD
A0A6I8NSR7_MCL1-01      PARRAPPEGTEPPPPSAAAAAAALLRPEDELDGYEPEAPAKRPAHLAVLD
A0A6I8PIR3_BCL2L1-      --------------------------------------------------
F6S8G3_BCL2A1-01        --------------------------------------------------
F7G6M3_BCL2L2-01        --------------------------------------------------
                                                                          

A0A6I8NSR7_MCL1-02      LPGQAGGSLPSTPPPDDRDDMADGLYRQSLELITHYLREQAAGRKD----
A0A6I8NSR7_MCL1-01      LPGQAGGSLPSTPPPDDRDDMADGLYRQSLELITHYLREQAAGRKD----
A0A6I8PIR3_BCL2L1-      ------------------------MSLRNYDLVRDFVSYKLAQRGHDWSR
F6S8G3_BCL2A1-01        --------------------MDDGVFWSVRALALDYLDDVLQTPRL----
F7G6M3_BCL2L2-01        -----------------MATPAPASVSDTRALVADFVGYKLRQKGF----
                                                       *   ::             

A0A6I8NSR7_MCL1-02      ----------------------EPRGRDRRALETLRRVGDGIQRNHETAF
A0A6I8NSR7_MCL1-01      ----------------------EPRGRDRRALETLRRVGDGIQRNHETAF
A0A6I8PIR3_BCL2L1-      LVDPEAPDTGAEGAEGGRAAPAAAEDDDEAVRRTLREAGDEFEVRYRRAF
F6S8G3_BCL2A1-01        --------------------GTVPSRTSRALQNVMFSVQGDVEKALKPCF
F7G6M3_BCL2L2-01        ----------------ACGAGPGEGPPAQPLHRAMRAAGDEFESRFRRAF
                                                         .:  . . .:     .*

A0A6I8NSR7_MCL1-02      QGM--LRKL-----------------------------------------
A0A6I8NSR7_MCL1-01      QGEGGLRRMREAGAPLPPPPSYVLSALPEPNGTPPPPPVPSPRRHAPQAG
A0A6I8PIR3_BCL2L1-      SDL-----------------------------------------------
F6S8G3_BCL2A1-01        DSL-----------------------------------------------
F7G6M3_BCL2L2-01        SDL-----------------------------------------------
                        ..                                                

A0A6I8NSR7_MCL1-02      -----------------------DIQKEEDLKAVSRVGTHVFND------
A0A6I8NSR7_MCL1-01      HPEGGGPEGRVPRRHPRFQRRDDELGPHRDAHLFRRLRGQALEEHQPGGL
A0A6I8PIR3_BCL2L1-      -------------------AWQLHITPATAYQSFEQVVNELFRD------
F6S8G3_BCL2A1-01        -------------------DVG---SVGAARRIFGQIVEKEFED------
F7G6M3_BCL2L2-01        -------------------ASQLHVTPGSAQQRFTQVSDELFQG------
                                                       . . .:    :        

A0A6I8NSR7_MCL1-02      ---------------------GTTNWGRIVTLISFGAF------VAKHLK
A0A6I8NSR7_MCL1-01      HRPPGREHHGGPGDHQEGLAGQTERLGRICGILPRGGHGRQRPERAPALR
A0A6I8PIR3_BCL2L1-      ---------------------G-VNWGRVVAFFAFGGALCVESADKEMGP
F6S8G3_BCL2A1-01        ---------------------GIVNWGRIVTIFVLGGIL-TKKLQRSGVP
F7G6M3_BCL2L2-01        ---------------------G-PNWGRLVAFFVFGAALCAESVNKEMEP
                                                . **:  ::  *.             

A0A6I8NSR7_MCL1-02      SINQEGCI----------DPLAESITEVLVTTKRDWLVKQKGWEG-FVEF
A0A6I8NSR7_MCL1-01      RGGQPGSRLGLSNKMMGGPPPPSPSDAQRLTSHRSRPAPGAGHPS-ELSL
A0A6I8PIR3_BCL2L1-      LVGRVG------------S----WMATYLDRRLDPWIRDNGGWDT-FVEL
F6S8G3_BCL2A1-01        LTRETR------------EEISCFIAEFTTHHAGEWIRQNGGWENGFLNK
F7G6M3_BCL2L2-01        LVGQVQ------------D----WMVAYLDTQLADWIRSSGGWAE-FTAL
                                                           .     *.       

A0A6I8NSR7_MCL1-02      FHVEDM------------------EGSVRNVLLLFAGVASLGAGLAYLIR
A0A6I8NSR7_MCL1-01      LPPGSFIYEAQRPAAQNWHRQAPSGGPARQ-----EGLGWFGDGY-----
A0A6I8PIR3_BCL2L1-      YGNDAAAQSRKDQERFNRWLL------TGLTVAAVLLLGSLFTRK-----
F6S8G3_BCL2A1-01        FEQKTV------------WSVLADI--SMKILGVLSHLKQFY--------
F7G6M3_BCL2L2-01        YGDGALEDARRLRE--GNWASVRTVLTGAVALGALVTVGAFFASK-----
                                                             :  :         

© 1998-2022Legal notice