Dataset for protein BCL-2-like of organism Oncorhynchus tshawytscha

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                          :    :
-------------------------------------------------------------------mtynnrelvvyyi
mslsksitratttmlnfqngvvggssypagtslyyfgetgavragaspkskvdtdlgngtgdmpprptsls-nvvkenvl
       a       h    gssyladd sply fd avc gaspk kvdl      gngtgtanddn--gvpci skf 
                                                              dtanm ki-s f  tf  
                                                               m  i p  m        
                                                                  e c  l        
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .* . .        :                                                         :: .: 
tykLsqRsy---pw-slplteasarteGdel---isgpevlthrngrvnltspgs-ppglspp-s-q---gltavkrvlr
snh lkvnnnddsfnqfgcepqmssnn---gssvegngslgnrdtrqsignvlsdpytrq---l-q-stmphetmheavk
ghr  d gf   adchienagedgdec pgagqcqapdagteypchtlaegrdvt vqh-tksrcptrkaaidra  e
     d    vcgdmv-g npnq - f -pnmpnsap mxn---ga nam t  a y nsrswkrd   map    
          n dk q    q p     d  t      fa wss-t a k    s    q  p p             
                      c                    qp    f                            
                                                   e                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   :    *        : : . :: .           * . :* **  ****:..:. **..:.    :      :  
dsvdefelrYtr-----dfsdlssqlhitpatay-sfesVmdevFrDGv-NWGRvvglfaFGgalcvecvekemshlvdr
eainkhrya qgmiaklaldercddmsfi-s---r--nn iktl s  tt    iasfve  avvsqhlknigrtpqigs
 iga l rl np vv    a m h  ylvs-m eqr re a  m          a      ti   s dsd gsc th
 vag i  m a            g   v     qh  ta                         m      r  n   en
                                                                              al
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:   :: ** .  . *: .:..*  :   :                                                  
iadwmttYLdnhiqpWiqsqggWdrFaEifgrd----------------------------------------------a
vgqkiav  nspqrn lvknna ngivrfyhvqlprgdppeetpqrdppeetpqgdsqsrppkgtpqrrppqetpqrdp-
 tge  e  lgdlhd   e    -a c l qkr                                              p
  r                    e-   h eq                                                
                              dm                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .               :                                                         
aa-vr-sqesskkwllvgvtlvagvlvgtlitqkr---------------------------------------------
--e--rdppylvtntglamagltslgatsammkr-qpvqyqvyvrtnyitsiqvvvfsspsgckhthyritphlrgvsvn
rrdssk wspfrrvfrapfm fspitielyflitclficnpippaqew h fpmdt                        
 dspkg -  ii pq i al a  aif agnahsqsad                                          
  rifh    r     r pr d   v  h l   np                                            
  p                i     s        a                                             
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
dvgslsrhrlpclsrliglsclsriarlpclsrliglsclcqiarlpcfhrlvrisclsrsvrfprpsrldrfprlsrrd
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       490       500       510       520         
....:....|....:....|....:....|....:....|....:....
                                                 
-------------------------------------------------
rfprfsrghqsapdpwvclpyrrpaagaarrgggsvtytlsptsrssgc
                                                 
                                                 
                                                 
                                                 
                                                 
© 1998-2023Legal notice