Dataset for protein BCL-2-like of organism Oncorhynchus tshawytscha

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C8CMB3_MCL1-02      MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKS
A0A8C8CMB3_MCL1-01      MSLSKSITRATTTMLNFQNGVVGGSSYPAGTSLYYFGETGAVRAGASPKS
A0A8C8D057_BCL2L1-      --------------------------------------------------
A0A8C8FJG7_BCL2L1-      --------------------------------------------------
A0A8C8LPV9_MCL1-01      MSLSKSIARATTTMLHFQNGGSSYLADDASPLYYFDGAVCAGASPKSKVD
A0A8C8D057_BCL2L1-      --------------------------------------------------
A0A8C8J941_BCL2L1-      --------------------------------------------------
A0A8C8GSY4_BCL2L1-      --------------------------------------------------
A0A8C8GSY4_BCL2L1-      --------------------------------------------------
A0A8C8GL24_BCL2-01      --------------------------------------------------
A0A8C8JWJ1_BCL2-02      --------------------------------------------------
A0A8C8JWJ1_BCL2-01      --------------------------------------------------
                                                                          

A0A8C8CMB3_MCL1-02      KVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHLSDRSNNDDSDGSLPCT
A0A8C8CMB3_MCL1-01      KVDTDLGNGTGDTPPRPTKLGVNVVKSNVLGNHLSDRSNNDDSDGSLPCT
A0A8C8D057_BCL2L1-      ----------------IMTYNNRELVVYYITYKLSQRDY---PFNHIGLT
A0A8C8FJG7_BCL2L1-      ----------------MMTYNNRELVVYYITYKLSQRDY---PFNHMELT
A0A8C8LPV9_MCL1-01      L------GNGTGDTPRPTTLGMNVVKTNVLDNHLSDRSN---NDDSLPCT
A0A8C8D057_BCL2L1-      -----------------MCINLPELVVYYITYKLSQRDY---PFNHIGLT
A0A8C8J941_BCL2L1-      -----------------MSYSNRELVVFFISYRLSQRNY---SCCQLGLE
A0A8C8GSY4_BCL2L1-      -----------------MSYSNRELVVFFISYKLSQRNY---PCCQLVLE
A0A8C8GSY4_BCL2L1-      -----------------MSYSNRELVVFFISYKLSQRNY---PCCQLVLE
A0A8C8GL24_BCL2-01      ------------MMANENPYNSRFIVEKYIHHKLLKVGF---VW-KFQ-G
A0A8C8JWJ1_BCL2-02      ------------MANDDN----RCIVEKYICHKLLKRGY---AW-DFENA
A0A8C8JWJ1_BCL2-01      ------------MANDDN----RCIVEKYICHKLLKRGY---AW-DFENA
                                                :    :  .* . .        :   

A0A8C8CMB3_MCL1-02      PQMASECGPELSNCQSGDEVLEHDTRQLIENVLVD-YTGLTPSRCKQSK-
A0A8C8CMB3_MCL1-01      PQMASECGPELSNCQSGDEVLEHDTRQLIENVLVD-YTGLTPSRCKQSK-
A0A8C8D057_BCL2L1-      EAPSRTEGDEGGQVEGGAAVTTHPNGTVNGTSPGT-PPRQSPPLSPQRTM
A0A8C8FJG7_BCL2L1-      EAQNCT---EGGQVEGGAAVMTY----VNGTSPGTPPPRQSPPSSPRRTA
A0A8C8LPV9_MCL1-01      PQMASECGPELSNCPSGDEVLEHDTRQLIENFLGD-YTGLSQPRWKQSK-
A0A8C8D057_BCL2L1-      EAPSRTEGDEGGQVEGGAAVTTHPNGTVNGTSPGT-PPRQSPPLSPQRTM
A0A8C8J941_BCL2L1-      GASGQTEGDEA---ISNGSVGNYWNSRSNLAKPSS-PQG-----------
A0A8C8GSY4_BCL2L1-      GASGRTEGDEA---IANGSLGNNRNGRSNLGMPSS-AQG-----------
A0A8C8GSY4_BCL2L1-      GASGRTEGDEA---IANGSLGNNRNGRSNLGMPSS-AQG-----------
A0A8C8GL24_BCL2-01      ENDSPNNGFGDPSTPNSPEVFARRSQPTAAGEDTD-SPYQNSS-PQPD--
A0A8C8JWJ1_BCL2-02      EEDADNNG----SMISPPPGLXRRCHGANNARPGS-VPHLSKRLSQTD--
A0A8C8JWJ1_BCL2-01      EEDADNNG----SMISPPPGLXRRCHGANNARPGS-VPHLSKRLSQTD--
                                                                          

A0A8C8CMB3_MCL1-02      ALTTMKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFI--------NSV
A0A8C8CMB3_MCL1-01      ALTTMKRVVKDIIAKHRYAYNGMIAKLDLDDRCDDMSFI--------NSV
A0A8C8D057_BCL2L1-      GLDAVKEALRDSANEFELRYAR-----AFSDLSSQLHITPATAYQSFENV
A0A8C8FJG7_BCL2L1-      GLDAVKEALRDSANEFELRYAR-----AFSDLSSQLHITPSTAYQSFENV
A0A8C8LPV9_MCL1-01      PLTTMKRVVEDVIAKHRYAYNGMVVKLDLDDRCDDMSVV--------NSV
A0A8C8D057_BCL2L1-      GLDAVKEALRDSANEFELRYAR-----AFSDLSSQLHITPATAYQSFENV
A0A8C8J941_BCL2L1-      GMEPVKAALRDSVDEFELRYTR-----AFSDLSSQLHITPATAYHSFESV
A0A8C8GSY4_BCL2L1-      GIEAVKAALRDSVDEFELRYTR-----AFSDLCSQLHITPATAYHSFESV
A0A8C8GSY4_BCL2L1-      GIEAVKAALRDSVDEFELRYTR-----AFSDLCSQLHITPATAYHSFESV
A0A8C8GL24_BCL2-01      PHARLHRVLREAGGEIERMYQR-----DFAEMSGQLHFTPSTAQRRFTAV
A0A8C8JWJ1_BCL2-02      PHAAIHRVLREAGDELERLYQP-----DFAEMSHQLYLTSSMAERRFREV
A0A8C8JWJ1_BCL2-01      PHAAIHRVLREAGDELERLYQP-----DFAEMSHQLYLTSSMAERRFREV
                            :: .: :   :    *        : : . :: .           *

A0A8C8CMB3_MCL1-02      AKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKITTYLL
A0A8C8CMB3_MCL1-01      AKTLFSDGTTNWGRIASLVAFGAVVSQHLKEIGRGHCIESVGQKITTYLL
A0A8C8D057_BCL2L1-      MDEVFRDGV-NWGRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLD
A0A8C8FJG7_BCL2L1-      MDEVFRDGV-NWGRVVGLFAFGGALCVECVDKEMNPLVGRITDWMTVYLD
A0A8C8LPV9_MCL1-01      AKTMFSDGITNWGRIASLVAFGAVVSQHLKESGRGHCVDLVGQEIATYLL
A0A8C8D057_BCL2L1-      MDEVFRDGV-NWGRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLD
A0A8C8J941_BCL2L1-      MDEVFRDGV-NWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLD
A0A8C8GSY4_BCL2L1-      MDEVFRDGV-NWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLD
A0A8C8GSY4_BCL2L1-      MDEVFRDGV-NWGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLD
A0A8C8GL24_BCL2-01      IDELFSDGV-NWGRIVAFFEFGGTMCVESVNREMTSQVDNIARWMTEYLN
A0A8C8JWJ1_BCL2-02      IDELFRDGV-NWGRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMAEYLN
A0A8C8JWJ1_BCL2-01      IDELFRDGV-NWGRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMAEYLN
                         . :* **  ****:..:. **..:.    :      :  :   :: ** 

A0A8C8CMB3_MCL1-02      SDQRDWLVKNNAWNGFVEFFHVQ---------------------------
A0A8C8CMB3_MCL1-01      SDQRDWLVKNNAWNGFVEFFHVQ---------------------------
A0A8C8D057_BCL2L1-      NHIQPWIQSQGGWDRFAEIFGKD---------------------------
A0A8C8FJG7_BCL2L1-      NHIQPWIQSQGGWDRFAEIFGMD---------------------------
A0A8C8LPV9_MCL1-01      SDQRDWLVKNNAWNGFVEFFHVQ---------------------------
A0A8C8D057_BCL2L1-      NHIQPWIQSQGGWDRFAEIFGKD---------------------------
A0A8C8J941_BCL2L1-      NHIQPWIQSQGGWDRFAEIFGRD---------------------------
A0A8C8GSY4_BCL2L1-      NHIQPWIQSQGGWDRFAEIFGRD---------------------------
A0A8C8GSY4_BCL2L1-      NHIQPWIQSQGGWDRFAEIFGRD---------------------------
A0A8C8GL24_BCL2-01      GPLQNWIQENGGWDAFVEIYEQQ---------------------------
A0A8C8JWJ1_BCL2-02      GPLHNWIQENGGW--ICRHFQRRLPRGDPPEETPQRDPPEETPQGDSQSR
A0A8C8JWJ1_BCL2-01      GPLHNWIQENGGWEAFVELYDRQ---------------------------
                        .  . *: .:..*  :   :                              

A0A8C8CMB3_MCL1-02      --------------------------DPESSVRNTLIAFAGFAGLGATLA
A0A8C8CMB3_MCL1-01      --------------------------DPESSVRNTLIAFAGFAGLGATLA
A0A8C8D057_BCL2L1-      -------------------AAAESRKSQESFKKWLLAGMTLVTGVIVGSL
A0A8C8FJG7_BCL2L1-      -------------------AAAESRKSQESFKKWFLAGMTLVTGVVVGSL
A0A8C8LPV9_MCL1-01      --------------------------DPESSVRNTLLAFAGVAGIGATLA
A0A8C8D057_BCL2L1-      -------------------AAAESRKSQESFKKWLLAGMTLVTGVIVGSL
A0A8C8J941_BCL2L1-      -------------------AAADVRRSQESIIKWLLVGVILLSGVLVGTL
A0A8C8GSY4_BCL2L1-      -------------------AAADVRRSQESLKKWLLVGVMLLSGVLVGTL
A0A8C8GSY4_BCL2L1-      -------------------AAADVRRSQESLKKWLLVGVMLLSGVLVGTL
A0A8C8GL24_BCL2-01      ----------------------RISHSWSYLKTVFGLAALGAAGVTIGAL
A0A8C8JWJ1_BCL2-02      PPKGTPQRRPPQETPQRDPPRRPPKGD-PPRRTPQRRPPRGDTPASFEHG
A0A8C8JWJ1_BCL2-01      --------------------RDSVFGSWPSIKTVFGLAALGAASLTIGAY
                                                  .               :       

A0A8C8CMB3_MCL1-02      MLISQPPIQNQIPVAQEWITSIPVVVFSSPSGCKHTHYRITPHLRGVSVN
A0A8C8CMB3_MCL1-01      MLIRNSAD------------------------------------------
A0A8C8D057_BCL2L1-      IAQKRL--------------------------------------------
A0A8C8FJG7_BCL2L1-      FAQKRL--------------------------------------------
A0A8C8LPV9_MCL1-01      MLIR----------------------------------------------
A0A8C8D057_BCL2L1-      IAQKRL--------------------------------------------
A0A8C8J941_BCL2L1-      IMKKRQ--------------------------------------------
A0A8C8GSY4_BCL2L1-      IMKKCQFVCYPVYPRTNYIHSFQMDT------------------------
A0A8C8GSY4_BCL2L1-      IMKKCQ--------------------------------------------
A0A8C8GL24_BCL2-01      FTQK----------------------------------------------
A0A8C8JWJ1_BCL2-02      NTHTA---------------------------------------------
A0A8C8JWJ1_BCL2-01      LTQK----------------------------------------------
                                                                          

A0A8C8CMB3_MCL1-02      DVGSLSRHRLPCLSRLIGLSCLSRIARLPCLSRLIGLSCLCQIARLPCFH
A0A8C8CMB3_MCL1-01      --------------------------------------------------
A0A8C8D057_BCL2L1-      --------------------------------------------------
A0A8C8FJG7_BCL2L1-      --------------------------------------------------
A0A8C8LPV9_MCL1-01      --------------------------------------------------
A0A8C8D057_BCL2L1-      --------------------------------------------------
A0A8C8J941_BCL2L1-      --------------------------------------------------
A0A8C8GSY4_BCL2L1-      --------------------------------------------------
A0A8C8GSY4_BCL2L1-      --------------------------------------------------
A0A8C8GL24_BCL2-01      --------------------------------------------------
A0A8C8JWJ1_BCL2-02      --------------------------------------------------
A0A8C8JWJ1_BCL2-01      --------------------------------------------------
                                                                          

A0A8C8CMB3_MCL1-02      RLVRISCLSRSVRFPRPSRLDRFPRLSRRDRFPRFSRGHQSAPDPWVCLP
A0A8C8CMB3_MCL1-01      --------------------------------------------------
A0A8C8D057_BCL2L1-      --------------------------------------------------
A0A8C8FJG7_BCL2L1-      --------------------------------------------------
A0A8C8LPV9_MCL1-01      --------------------------------------------------
A0A8C8D057_BCL2L1-      --------------------------------------------------
A0A8C8J941_BCL2L1-      --------------------------------------------------
A0A8C8GSY4_BCL2L1-      --------------------------------------------------
A0A8C8GSY4_BCL2L1-      --------------------------------------------------
A0A8C8GL24_BCL2-01      --------------------------------------------------
A0A8C8JWJ1_BCL2-02      --------------------------------------------------
A0A8C8JWJ1_BCL2-01      --------------------------------------------------
                                                                          

A0A8C8CMB3_MCL1-02      YRRPAAGAARRGGGSVTYTLSPTSRSSGC
A0A8C8CMB3_MCL1-01      -----------------------------
A0A8C8D057_BCL2L1-      -----------------------------
A0A8C8FJG7_BCL2L1-      -----------------------------
A0A8C8LPV9_MCL1-01      -----------------------------
A0A8C8D057_BCL2L1-      -----------------------------
A0A8C8J941_BCL2L1-      -----------------------------
A0A8C8GSY4_BCL2L1-      -----------------------------
A0A8C8GSY4_BCL2L1-      -----------------------------
A0A8C8GL24_BCL2-01      -----------------------------
A0A8C8JWJ1_BCL2-02      -----------------------------
A0A8C8JWJ1_BCL2-01      -----------------------------
                                                     

© 1998-2023Legal notice