Dataset for protein Bcl-w of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   *. .*.*. *         :*  .*   * * *   . : * :.   .  * *.   *: .. ..     ***.   
--mAtpaSaPdtRalvadfvgykLrqkGyvcGaGpGegpaadpLhqamraagdEfEtrfrRtfsdlaaqlhvtPGSaqqr
glr vrg g gr r--------h vpr rwg r g prgpeel lepepepep e pprp appgapgp---g   gapg

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  : .:*  *.:*.*. * :                                              .   *         
ftqvsdE--LfqGgPnwGrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihssggwelEaikarvrem
sqeeee pg ve d gd ai---------------------------------------------edpa- ftalygdga

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *** .*.*               ** ..*            *:: .* *  ** .                        
eEEAekLkElqnevekqmnmspppGNagpVimsieekmeadaRsiyvGnVdyGAtaeeleahfhgcgsvnrvtilcdkfs
l   rr r ---------------  was ------------ tvlt a al  lvt-----------------------

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrpr
--------------------------------------------------------------------------------

       330       
....:....|....:..
         . ::::. 
grvyrgraratswyspy
---------vgaffask
© 1998-2022Legal notice