Dataset for protein Bcl-w of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3GEA7_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRA
A0A2I3GEA7_BCL2L2-      GLRAVRGSGPGRRR--------HLVPRGRWGGRGGGPRGPEELLLEPEPE
A0A2I3GEA7_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRA
                           *. .*.*. *         :*  .*   * * *   . : * :.   

A0A2I3GEA7_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQGGPNWGRL
A0A2I3GEA7_BCL2L2-      PEPEEEPPRPRAPPGAPGP---GPGSGAPGSQEEEEEPGLVEGDPGDGAI
A0A2I3GEA7_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDE--LFQGGPNWGRL
                        .  * *.   *: .. ..     ***.     : .:*  *.:*.*. * :

A0A2I3GEA7_BCL2L2-      VAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWA-
A0A2I3GEA7_BCL2L2-      ---------------------------------------------EDPEL
A0A2I3GEA7_BCL2L2-      VAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWEL
                                                                      .   

A0A2I3GEA7_BCL2L2-      EFTALYGDGALEEARRLRE---------------GNWASV----------
A0A2I3GEA7_BCL2L2-      EAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
A0A2I3GEA7_BCL2L2-      EAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEA
                        *          *** .*.*               ** ..*          

A0A2I3GEA7_BCL2L2-      --RTVLTGAVALGALVT---------------------------------
A0A2I3GEA7_BCL2L2-      DARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIE
A0A2I3GEA7_BCL2L2-      DARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIE
                          *:: .* *  ** .                                  

A0A2I3GEA7_BCL2L2-      --------------------------------------------------
A0A2I3GEA7_BCL2L2-      FSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRAR
A0A2I3GEA7_BCL2L2-      FSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRAR
                                                                          

A0A2I3GEA7_BCL2L2-      -----------------------------VGAFFASK
A0A2I3GEA7_BCL2L2-      TTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2I3GEA7_BCL2L2-      TTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                                     . ::::. 

© 1998-2022Legal notice