Dataset for protein Bfl1 of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKPCLDNVNVVSIDTARTLFNQVMEKEFE
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************************ :           * ..: :
DGIINWGRIVTIFAFEGILVKKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWgn-----------Wmthmpv
                                                            ekgfvkkfepksg hnflem

       170       180       190       200     
....:....|....:....|....:....|....:....|....:
                        *:*::*:.   : :       
------------------------LvEtvAntyrymkl-------
tgkisilltrkdtpycetgliflt m si hkkfkfainnfddvt
© 1998-2020Legal notice