Dataset for protein Bfl1 of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HBP6_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
A0A2I3HBP6_BCL2A1-      MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
                        **************************************************

A0A2I3HBP6_BCL2A1-      NLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILV
A0A2I3HBP6_BCL2A1-      NLKPCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILV
                        **************************************************

A0A2I3HBP6_BCL2A1-      KKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
A0A2I3HBP6_BCL2A1-      KKLLRQRTAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK--------
                        **************************************** :        

A0A2I3HBP6_BCL2A1-      KSGWMTFLEVTGKISILLTRKDTPYCETGLIFLTLMETIANTYFYFKINN
A0A2I3HBP6_BCL2A1-      ---WHNHMPM------------------------LVESVAHKKRKMAL--
                           * ..: :                        *:*::*:.   : :  

A0A2I3HBP6_BCL2A1-      FDDVT
A0A2I3HBP6_BCL2A1-      -----
                             

© 1998-2020Legal notice