Dataset for protein BCL-2-like of organism Myripristis murdjan

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      ::*    .       :   : *: *                             :.:*...  ...   :    
-----rnlVvkrityklsqsnypfpqnGvvE-----------------------------tpkRtknlgvngftaknsrd
msysnmei sfyanigaigrcfitnhl li gqmyygsgdsspqiamastlengnavssdssn peggqagavisq--gt
 msq       f            c i  e                              a e  d dd d aeenrvas
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :..  ..  * **         ..   .  . : .: :.:  :   : . :..* .. .    .*  ::: *:::*   
dstdnddgslPgTP---elqsdssadvsgspavkavvdnstrhlvltylrdysgL-srprwtpdtAyetmksVveeV---
lansttnats c  pas------epsytslevgeealredanefeerftqafns sdqlhireak lqsfer mdd lek
h  grlgq       p rrer  ptg id      qd       a    d h           h            
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               * :* .****:..*.***..:*    *.  .  *. ::  ::.** .  
-------------------------------FrdG-vNWGRvvsLvAFGgvvCvhlvEkgrdhlVssvsrwmttYLlshq
hryayngmvrkvaldergddmsfvtsvaksl gn tt    iag f   aal qecr remsqc priaeeisv  dndi
                                                           n              
                                                                                

       250       260       270       280       290        
....:....|....:....|....:....|....:....|....:....|....:...
  *:  :..*: *.*::   *. :  *.:  ::  :   * .*   :           
rpWlirnnsWdrFvEiyr-aDpestvRrtqmsfrgwlliGatLatlvr----------
qe iqsqgg eg a ffgvr aaaeg nalealarfagv vv vlgivvgsliaqkrp
  e            q     a        k   a m  l   ll a   k hl
                                                f         
© 1998-2020Legal notice