Dataset for protein BCL-2-like of organism Myripristis murdjan

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667YZT5_MCL1-01      -----MNIVSKRATIGAIGSCFIFPQNGVVEGQMYYGSGDSSPQIAMAST
A0A667YZT5_MCL1-02      -----MNIVSKRATIGAIGSCFIFPQNGVVEGQMYYGSGDSSPQIAMAST
A0A667Y1V0_BCL2L1-      MSYSNRELVVFFINYKLSQRNYPTCQLGLEE-------------------
A0A667ZHE8_BCL2L1-      -MSQNRELVVFYITYKLSQRNYPFNHIGLIE-------------------
                              ::*    .       :   : *: *                   

A0A667YZT5_MCL1-01      LENGNAVSSDTPKRPKNLGVNGFTAKNSRDDSTDNDDGSLPCTP---ELQ
A0A667YZT5_MCL1-02      LENGNAVSSDTPKRPKNLGVNGFTAKNSRDDSTDNDDGSLPCTP---ELQ
A0A667Y1V0_BCL2L1-      ----------ASERTEGDDADAVISN--GSLANSRTGAGQPGTP------
A0A667ZHE8_BCL2L1-      ----------SPNRTDGGQAGAAEEQRVATHANGTLNGTSPGTPPASPLR
                                  :.:*...  ...   :     :..  ..  * **      

A0A667YZT5_MCL1-01      SDSEADVSGSPAGEAVVDNDTRHLVETFLRDYSGL-SRPRWREDKALETM
A0A667YZT5_MCL1-02      SDSEADVSGSPAGEAVVDNDTRHLVETFLRDYSGL-SRPRWREDKALETM
A0A667Y1V0_BCL2L1-      ---SPPYGGIEVVKAALQESADEFELRYTQAFSSLSSQLHITPATAYHSF
A0A667ZHE8_BCL2L1-      RERSASTTSLDAVKEALRDSANEFELRYARAFNDLHDQLHITPATAYQSF
                           ..   .  . : .: :.:  :   : . :..* .. .    .*  ::

A0A667YZT5_MCL1-01      KRVVEDVLEKHRYAYNGMVRKVALDERGDDMSFVTSVAKSLFGDGTTNWG
A0A667YZT5_MCL1-02      KRVVEDVLEKHRYAYNGMVRKVALDERGDDMSFVTSVAKSLFGDGTTNWG
A0A667Y1V0_BCL2L1-      ESVMDEV----------------------------------FRNG-VNWG
A0A667ZHE8_BCL2L1-      ESVMDEV----------------------------------FRDG-VNWG
                        : *:::*                                  * :* .***

A0A667YZT5_MCL1-01      RIASLVAFGAVVCQHLREKGRDHCVSSVSREISTYLLSDQREWLIRNNSW
A0A667YZT5_MCL1-02      RIASLVAFGAVVCQHLREKGRDHCVSSVSREISTYLLSDQREWLIRNNSW
A0A667Y1V0_BCL2L1-      RVVGLFAFGGALCVECVERDMNQLVPRIADWMTTYLDNHIEPWIQREGGW
A0A667ZHE8_BCL2L1-      RVVGLFAFGGALCVECVEKEMSPLVSRIAEWMTVYLDNHIQPWIHSQGGW
                        *:..*.***..:*    *.  .  *. ::  ::.** .    *:  :..*

A0A667YZT5_MCL1-01      DGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIR----------
A0A667YZT5_MCL1-02      DGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIRF---------
A0A667Y1V0_BCL2L1-      DRFAEIYG-RDAAAEARRAQESLRRWLLVGVVLLTGVLLGALIAKKHP
A0A667ZHE8_BCL2L1-      ERFAEIYG-QDAAAEGRRAQESFRKWLLAGMTLVTGVVVGSLIAQKRL
                        : *.*::   *. :  *.:  ::  :   * .*   :           

© 1998-2020Legal notice