Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
matpastpdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlhvtpgsaqqrft

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  **********************************************
----------------------------------MEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
qvsdelfqggpnwgrlvaffvfgaalcaesvnke                                              

       170       180       190   
....:....|....:....|....:....|...
*********************************
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
                                 
© 1998-2020Legal notice