Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
matpastpdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlhvtpgsaqqrft
--------------------------------------------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  ***                                           
qvsdelfqggpnwgrlvaffvfgaalcaesvnkeMEPlvgqvqdwmvayletrladwihssggwaeftalygdgal----
----------------------------------   ---------------------------------------eear
                                                                vrssq llsas     

       170       180       190   
....:....|....:....|....:....|...
                                 
-lregnwasvrtvltgavalgal----------
r----------------------vtvgaffask
 ykv lhgkigplmg wgca kg          
© 1998-2022Legal notice