Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
matpastpdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtfsdlaaqlhvtpgsaqqrft
--------------------------------------------------------------------------------
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  ***                                           
qvsdelfqggpnwgrlvaffvfgaalcaesvnkeMEPlvgqvqdwmvayletrladwihssggwaeftalygdgalee--
----------------------------------   -----------------------------------------ar
                                                                vrssqklrvrsm  ea
                                                                eleai alsae     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-lregnwasvrtvmtgavalgal--v------k-----------------------------------------------
r----l-------l---------vt-gaffas-meadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpk
eylve-qnkigpq-nmwppp nggp imslee                                                
 kkk  hge ekl g sgca ka                                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfprsryrarttnynssrsrfysgfnsrprgriy
                                                                                
                                                                                

       330   
....:....|...
             
-------------
rgraratswyspy
             
             
© 1998-2022Legal notice