Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-02      --------------------------------------------------
P70345_BCL2L2-04      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
P70345_BCL2L2-03      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
P70345_BCL2L2-01      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                        

P70345_BCL2L2-02      --------------------------------------------------
P70345_BCL2L2-04      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
P70345_BCL2L2-03      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
P70345_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                                                                        

P70345_BCL2L2-02      --------------MEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTAL
P70345_BCL2L2-04      VFGAALCAESVNKEMEP---------------------------------
P70345_BCL2L2-03      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWVRSSQL
P70345_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTAL
                                    ***                                 

P70345_BCL2L2-02      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
P70345_BCL2L2-04      -------------------------------------------
P70345_BCL2L2-03      LLSASL-----YKVGLHGKIGPLMGGWGCAGKG----------
P70345_BCL2L2-01      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
                                                                 

© 1998-2022Legal notice