Dataset for protein Bcl-w of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P70345_BCL2L2-03      --------------------------------------------------
D3Z5F7_BCL2L2-01      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
P70345_BCL2L2-05      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
P70345_BCL2L2-01      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
P70345_BCL2L2-04      MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                                                                        

P70345_BCL2L2-03      --------------------------------------------------
D3Z5F7_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
P70345_BCL2L2-05      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
P70345_BCL2L2-01      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
P70345_BCL2L2-04      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                                                                        

P70345_BCL2L2-03      --------------MEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTAL
D3Z5F7_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWELEAIK
P70345_BCL2L2-05      VFGAALCAESVNKEMEP---------------------------------
P70345_BCL2L2-01      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTAL
P70345_BCL2L2-04      VFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWVRSSQL
                                    ***                                 

P70345_BCL2L2-03      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-------
D3Z5F7_BCL2L2-01      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARS
P70345_BCL2L2-05      --------------------------------------------------
P70345_BCL2L2-01      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-------
P70345_BCL2L2-04      LLSASL-----YKVGLHGKIGPLMGGWGCAGKG-----------------
                                                                        

P70345_BCL2L2-03      --------------------------------------------------
D3Z5F7_BCL2L2-01      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
P70345_BCL2L2-05      --------------------------------------------------
P70345_BCL2L2-01      --------------------------------------------------
P70345_BCL2L2-04      --------------------------------------------------
                                                                        

P70345_BCL2L2-03      --------------------------------------------------
D3Z5F7_BCL2L2-01      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRSRYRARTTNY
P70345_BCL2L2-05      --------------------------------------------------
P70345_BCL2L2-01      --------------------------------------------------
P70345_BCL2L2-04      --------------------------------------------------
                                                                        

P70345_BCL2L2-03      ---------------------------------
D3Z5F7_BCL2L2-01      NSSRSRFYSGFNSRPRGRIYRGRARATSWYSPY
P70345_BCL2L2-05      ---------------------------------
P70345_BCL2L2-01      ---------------------------------
P70345_BCL2L2-04      ---------------------------------
                                                       

© 1998-2022Legal notice