Dataset for protein BCL-2-like of organism Monodon monoceros

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************                                           
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLL-------------------------------------------
                                     aagkeatagrevgggeageviggsagpsppatlapdarrvarp

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
spigaegpdvtatparllffaptrrasppeemessvsdaimspeeeldgcepeplgkrpsvlpllelvgeasnspgkdgs

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              **************************************************
------------------------------ATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
lpstpppaeeeedelyrqsleiisrylreq                                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
                                                                                

       330       340       350 
....:....|....:....|....:....|.
*******************************
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                               
© 1998-2021Legal notice