Dataset for protein BCL-2-like of organism Monodon monoceros

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4V5P8C2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monodon monoceros GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSVSDAIMSPEEELDGCEPEPLGKRPSVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4V5P8C2_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Monodon monoceros GN=MCL-1 (length=198 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGML
RKLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGW
DGFVDFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2021Legal notice