Dataset for protein BCL-2-like of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--mlgpakk-----lvndyigyklyqkg--ag-gagggatgppsgrrllasgkgptvestppqrd---------------
mmdat-fsapdtre--aavl-ln-rcg-ya--m---e--s-----g---------es--------ggevetgtagaglig
 d-y-g-y-ysnhaia--fvs--c--- vqwstfpd-nr-tellh-amrvavdef--rfrrtfsa  dygn leaee ep
  a-pfrrshevar  tk--khv srr  ncaq eaa plsv gspsipsv assppwhpastqp               
   hkchmre   m  r   h c   e  e  a     dgrg eraeh pt n g avgifdsg                
    ea lg       m   e                   ea a      p   a  geg  g                 
    a  a        i                                                               
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------v-pg--------------------------a--r------e---g-------------------------
ggirlsppnp-s--argvarpapigaeapdvttdpmpslf-pg-cssvpa-vad-aadwgrlvaffvfgvpmcpeeeldg
eellaaaqlhpt esepprpr  p  sg gpgagapg qeeqqeftqasddlfq gpn           aal a svnke
     e epe e  e                          ee pgl eg pg   ie                      
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------g--le-i----re------klkplrs-------
yepeppgkrpsrlavleiareggdspngslpstpppaeedeeedely-qs--l-sryv--qevgtkeatetqnevekqmn
m  lvgqvqdwmvty  tqladwihss                    dwe  a karl  maeeae-sqtpptssalnpt
                                                p                 vqlaaglpasagkh
                                                                  rng   hg c da 
                                                                   e    aa      
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :      .                                 .    :     .. .  . . *.     
-----gnalptlrsvgdkvqrnyrrafvgmlryldikneeeak-----svnrV---vlsdgitnwgrivalisFgg----
msppp-k-gevimrieegmeadhesiyq-nvdkgataevldihfhgcgafsvatthifcrkfsghpkgftyfe s-fvak
vtivvp-v--i qqassefsqraqkdmet-tsqnhltprtayq    riets akeemf dgv    vavfvv aaalce
sq   av kqa  l afslrliv df selsgt q vsg srr    vfaq  m nl e  vi       i a   vml 
e     a hl   k   d   e     ddccal   ld  peg    s       k  d  ef             i   
             e                                                                  
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              .                :   :      .:  :  .                              
----------ks-nkesvr------tsma--ltdyLvrtkriwlipnggw-rgfvsttdrgfprar------------ra
heellkeeqv--idrdmcilvmgtqdpl-esidevifkgrqdkvqkqrtnevpgie-fe--av-pgdpcapssaylly--
m        leqvrqhtsprt    geitswmats nnhlht irek  ttl--vd-vr--wg-           lst
         ilkll  rev l    erkslf cnf merigp  hq     s klrq-tpqtts-s            nr
                 a           h      ddn de   d     n ahknypnnqsptp            ik
                                        aa         k  ehl hkelleen            fd
                                                   e   ah geddaa              c 
                                                   d    f                       

       410       420       430       440       450
....:....|....:....|....:....|....:....|....:....|
                                                  
ratnysssrsrfysgf---pr------r----------------------
----------------nsr--grvyrg-aratswyspynkfstsmithgl
svltwwcgltavgavvgyvllnvltvvkkw a lqrsh            
nssrtnwwimtsmthlpvli as lsr       fl              
gqnlklrqvlsglk aalkg  l fee                       
epeffiac fgaac   d                                
di  af   a                                        
                                                  
© 1998-2022Legal notice