Dataset for protein BCL-2-like of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
                   :. . :                                                 . .   
     m---kgrrsysvhriam fikhv---r--qwsqf    denrtrvpespsipsvvnss swhifstrpvqqtpgl
      d hefhmrhdtam  i   h ccrrk vn          g lealaga   pt aga avg adsqarnl l h
          cal e          e     e  e                                        g a a

       170       180       190       200       210       220       230       240
  .                                                      *. ..  .       :.      
ssal--t---------edeeedelygqslelisrylreqavgtkeakplrsgkal-i qqassefsqrhrkdme--tsqn
pacagp-vtpvvavvk                                       qa  l afslrlivqdf stlsgt 
  dkhssip  a h                                       l   k   d e e     deccal 
     a eq                                                  e              d     

       250       260       270       280       290       300       310       320
 :        .   .    :  .  ****:..:. *.. :           : .: .                :   :  
hltpvtayqrivnsvmteelfrdgv    vaaffv aaalckheellkeeqleqvrqhmsplvmgtqtei--wmaevinr
q vsr srrvfft   knlm vi      vive   vm-em        ilkllk tevrt    gskts-lctf mn
  ldg pegs eq    k   ef         a   i l              d  rar l    er slf  n  de
       a   a                                                           h       d

       330       340       350       360       370       380       390       400
    *: .: **                                                                    
hlht iqeqk  ettl--vd-vr--wg-stsssttnywlltanvlfgwvglaslgvvvpylprnvlteerkwaaslqrsh
rigp  rq     s klrq-trqtts-srpgqpsslwlimsrmtvlwvcqvtlvlsrradki                  
n de  hd     n ahknyppnqsrtpfkdinrkirg fnglpgaalal ggsfchl                      
  aa         k  ehl hngllpenddcaenfacc  ifek   f    a  agk                      
             e   ah gkedae              c aa                                    
             d    f  ed  a              a                                       

© 1998-2020Legal notice