Dataset for protein BCL-2-like of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6ZMX1_MCL1-01         MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTP
F6ZMX1_MCL1-03         MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTP
F6ZMX1_MCL1-02         MLGPFKKNAVIGLNLYCGGAGMGAGGGASGPPSGGRLLASGKGPTVESTP
F6WA14_BCL2L1-01       --------------------------------------------------
F6SFL4_BCL2A1-01       --------------------------------------------------
F6VJQ0_BCL2L10-01      --------------------------------------------------
F6YNL8_BCL2-01         --------------------------------------------------
                                                                         

F6ZMX1_MCL1-01         PQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDV
F6ZMX1_MCL1-03         PQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDV
F6ZMX1_MCL1-02         PQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVARPAPIGAEAPDV
F6WA14_BCL2L1-01       ------------------------------------------MSHSNREL
F6SFL4_BCL2A1-01       -----------------------------------MDDYEFHY---VHML
F6VJQ0_BCL2L10-01      ------------------------------------MDYKCALREETARL
F6YNL8_BCL2-01         -----------------------------------MMAHPGRRGYDNREI
                                                                        :

F6ZMX1_MCL1-01         TTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSR
F6ZMX1_MCL1-03         TTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSR
F6ZMX1_MCL1-02         TTDPMPSLFAPGRCSSAPAEVADGAADVPMCPEEELDGYEPEPPGKRPSR
F6WA14_BCL2L1-01       VIDFLSYKLSQKGYNWSQFE---DENRTEVLEGAEIPSTVNGSPSWHPAD
F6SFL4_BCL2A1-01       ARDYLKHV------------------------------------------
F6VJQ0_BCL2L10-01      VTDYLEYCCRREGVQ-----------------------------------
F6YNL8_BCL2-01         VMKYIHYKLSQRGYEW-------DAGDLRAPASPSLPPVVASAPAVGIFS
                       . . :                                             

F6ZMX1_MCL1-01         LAVLEIAREGGDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQA
F6ZMX1_MCL1-03         LAVLEIAREGGDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQA
F6ZMX1_MCL1-02         LAVLEIAREGGDSPNGSLPSTPPPAEEDEEEDELYGQSLELISRYLREQA
F6WA14_BCL2L1-01       SRAVSGATGHSSSLDAHETIPVAAVK------------------------
F6SFL4_BCL2A1-01       ----QQTPPLGSCLNKTSQ-------------------------------
F6VJQ0_BCL2L10-01      ----ELPAPTPAAA------------------------------------
F6YNL8_BCL2-01         TQPRNTPLPAAAAAGPTVSPVPPVVH------------------------
                           . .     .                                     

F6ZMX1_MCL1-01         VGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIKA
F6ZMX1_MCL1-03         VGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIKA
F6ZMX1_MCL1-02         VGTKEAKPLRSGKALETLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIKA
F6WA14_BCL2L1-01       ---------------QALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS
F6SFL4_BCL2A1-01       ----------------ILQKVAFSVQQEVEKDMETCLSTLDIVSVESARR
F6VJQ0_BCL2L10-01      ----------------TLRLVSSELRQIYQDFFE--CALNQLLDREPEQV
F6YNL8_BCL2-01         ---------------LTLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARGR
                                        *. ..  .       :.       :        

F6ZMX1_MCL1-01         VSRVA-THVFSDGITNWGRIVTLISFGAFVAKH--------LKSINQESC
F6ZMX1_MCL1-03         VSRVA-THVFSDGITNWGRIVTLISFGAFVAKH--------LKSINQESC
F6ZMX1_MCL1-02         VSRVA-THVFSDGITNWGRIVTLISFGAFVAKH--------LKSINQESC
F6WA14_BCL2L1-01       FEQVV--NELFRDGVNWGRIVAFFSFGGALC----------VESVDKEME
F6SFL4_BCL2A1-01       IFNSVMKKEFEDGVINWGRIVTIFAFGGIL-----------IKKLLRHRA
F6VJQ0_BCL2L10-01      IVNVA--ELMDRGEFNWGRVAVLVVFAGALLEMEELLKEEQVLQLRRETS
F6YNL8_BCL2-01         FATVV--EELFRDGVNWGRIVAFFEFGGVMC----------VESVNREMS
                       .   .    :  .  ****:..:. *.. :           : .: .   

F6ZMX1_MCL1-01         I------DPLAESITDVLVKTKRDWLIKQKGW-KGLLAQDTEEATRTGDP
F6ZMX1_MCL1-03         I------DPLAESITDVLVKTKRDWLIKQKGW-EGFVEFFHVQDLEGG--
F6ZMX1_MCL1-02         I------DPLAESITDVLVKTKRDWLIKQKGW-SGKERVDPRGLVSGG--
F6WA14_BCL2L1-01       VLV----GRITSWMATYLDDHLDPWIQENGGW-DTFVELYGNDAAAESRK
F6SFL4_BCL2A1-01       PLTMGTQEEISHFIAEFIMNNIAEWIRQNGGWENGFVKNFEPNTVWPNFT
F6VJQ0_BCL2L10-01      RRL----TEK---LCNYLVERKGAWLHENGGW-TGFHHHFEKRQSPPPSD
F6YNL8_BCL2-01         PLV----DSIALWMTEYLNRHLHTWIQDNGGW-VGA--------------
                                    :   :      *: .: **                  

F6ZMX1_MCL1-01         CAPSSAYLLLCAEPLFWWCQLTASGCHVPDKPRNVLTEERKWAASLQRSH
F6ZMX1_MCL1-03         ----------IRNVLLAFAGVAGVGAGLAYLIR-----------------
F6ZMX1_MCL1-02         ----------N---------------------------------------
F6WA14_BCL2L1-01       GQERFNRWLLTGMTVAGVVLLGSLFSRK----------------------
F6SFL4_BCL2A1-01       DISTKIWGIFSFLK------------------------------------
F6VJQ0_BCL2L10-01      SSNNTLCCIMAAAAGFGLVGLALLLVVR----------------------
F6YNL8_BCL2-01         --------------------------------------------------
                                                                         

F6ZMX1_MCL1-01         NKFSTSMITHGL
F6ZMX1_MCL1-03         ------------
F6ZMX1_MCL1-02         ------------
F6WA14_BCL2L1-01       ------------
F6SFL4_BCL2A1-01       ------------
F6VJQ0_BCL2L10-01      ------------
F6YNL8_BCL2-01         ------------
                                   

© 1998-2020Legal notice