Dataset for protein BCL-2-like of organism Monodelphis domestica

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F8HG85_BCL2L2-      --MAAAAAA--------------------AAAAGAAGGRGSGPGRRRHLV
A0A5F8HG85_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYACGTGPGEGPTTEPLHRAMRA
A0A5F8HG85_BCL2L2-      --MATPASAPDTRALVADFVGYKLRQKGYACGTGPGEGPTTEPLHRAMRA
A0A5F8GAQ2_MCL1-01      --MLGPFKK-------NAVIGLNLYCGG--AGMGAGGGASGPPSGGRLLA
A0A5F8GAQ2_MCL1-02      --MLGPFKK-------NAVIGLNLYCGG--AGMGAGGGASGPPSGGRLLA
A0A5F8GAQ2_MCL1-03      --MLGPFKK-------NAVIGLNLYCGG--AGMGAGGGASGPPSGGRLLA
F6WA14_BCL2L1-01        -------MSHSNRELVIDFLSYKLSQKGYNWSQFEDENRTEVLEGAEIPS
F6SFL4_BCL2A1-01        MDDYEFHY---VHMLARDYLKHV---------------------------
F6VJQ0_BCL2L10-01       -MDYKCALREETARLVTDYLEYCCRREGVQ--------------------
F6YNL8_BCL2-01          MMAHPGRRGYDNREIVMKYIHYKLSQRGYEW----DAGDLRAPASPSLPP
                                                                          

A0A5F8HG85_BCL2L2-      PGAGGEPGEGAPGGA-GDYGNGLEAEELEPEELLLEPEPEPEPEEEPPRP
A0A5F8HG85_BCL2L2-      AGDEFESRFRRTFSD-------------------LAAQLHVTPGS-----
A0A5F8HG85_BCL2L2-      AGDEFESRFRRTFSD-------------------LAAQLHVTPGS-----
A0A5F8GAQ2_MCL1-01      SGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVAR
A0A5F8GAQ2_MCL1-02      SGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVAR
A0A5F8GAQ2_MCL1-03      SGKGPTVESTPPQRDGGEVETGTAGAGLIGGGIRASPPNPVSPGARGVAR
F6WA14_BCL2L1-01        TVNGSPSWHPADSRA-----------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
F6YNL8_BCL2-01          VVASAPAVGIFSTQP-----------------------------------
                                                                          

A0A5F8HG85_BCL2L2-      RAPPGASGPGPGAGAPGSQEEEEEPGLVEGDPGDGAIE------------
A0A5F8HG85_BCL2L2-      --------------------AQQRFTQVSDELFQGGPNWGRLVAFFVFGA
A0A5F8HG85_BCL2L2-      --------------------AQQRFTQVSDELFQGGPNWGRLVAFFVFGA
A0A5F8GAQ2_MCL1-01      PAPIGAEAPDVTTDPMPSLFAPGRCSSAPAEVADGAAD-----------V
A0A5F8GAQ2_MCL1-02      PAPIGAEAPDVTTDPMPSLFAPGRCSSAPAEVADGAAD-----------V
A0A5F8GAQ2_MCL1-03      PAPIGAEAPDVTTDPMPSLFAPGRCSSAPAEVADGAAD-----------V
F6WA14_BCL2L1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
                                                                          

A0A5F8HG85_BCL2L2-      --------------------------------------------------
A0A5F8HG85_BCL2L2-      ALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIHSSG------------
A0A5F8HG85_BCL2L2-      ALCAESVNKEMEPLVGQVQDWMVTYLETQLADWIHSSG------------
A0A5F8GAQ2_MCL1-01      PMCPEEELDGYEPEPPGKRPSRLAVLEIAREGGDSPNGSLPSTPPPAEED
A0A5F8GAQ2_MCL1-02      PMCPEEELDGYEPEPPGKRPSRLAVLEIAREGGDSPNGSLPSTPPPAEED
A0A5F8GAQ2_MCL1-03      PMCPEEELDGYEPEPPGKRPSRLAVLEIAREGGDSPNGSLPSTPPPAEED
F6WA14_BCL2L1-01        --------------------------------------------------
F6SFL4_BCL2A1-01        --------------------------------------------------
F6VJQ0_BCL2L10-01       --------------------------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
                                                                          

A0A5F8HG85_BCL2L2-      -------DPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
A0A5F8HG85_BCL2L2-      -------GWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
A0A5F8HG85_BCL2L2-      -------GWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGP
A0A5F8GAQ2_MCL1-01      EEEDELYGQSLELISRYLREQAVGTKEAKPLRS------------GKALE
A0A5F8GAQ2_MCL1-02      EEEDELYGQSLELISRYLREQAVGTKEAKPLRS------------GKALE
A0A5F8GAQ2_MCL1-03      EEEDELYGQSLELISRYLREQAVGTKEAKPLRS------------GKALE
F6WA14_BCL2L1-01        --------------------------VSGATGHSSSLDAHETIPVAAVKQ
F6SFL4_BCL2A1-01        ---------------------------QQTPPLGSCLNKTSQ--------
F6VJQ0_BCL2L10-01       ---------------------------ELPAPTPAAA-------------
F6YNL8_BCL2-01          --------------------------RNTPLPAAAAAGPTVSPVPPVVHL
                                                                          

A0A5F8HG85_BCL2L2-      VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT--ILCD
A0A5F8HG85_BCL2L2-      VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT--ILCD
A0A5F8HG85_BCL2L2-      VIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT--ILCD
A0A5F8GAQ2_MCL1-01      TLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIK-----AVSRVATHVFSD
A0A5F8GAQ2_MCL1-02      TLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIK-----AVSRVATHVFSD
A0A5F8GAQ2_MCL1-03      TLRRVGDGVQRNHERAFQGMLRKLDIKNEEDIK-----AVSRVATHVFSD
F6WA14_BCL2L1-01        ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQ----SFEQVV--NELFR
F6SFL4_BCL2A1-01        ILQKVAFSVQQEVEKDMETCLSTLDIVSVESAR----RIFNSVMKKEFED
F6VJQ0_BCL2L10-01       TLRLVSSELRQIYQDFFE--CALNQLLDREPEQ----VIVNVA--ELMDR
F6YNL8_BCL2-01          TLRQAGDDFSRRYRRDFDEMSGQLHLTPVTARG----RFATVV--EELFR
                         :      .                                 .    :  

A0A5F8HG85_BCL2L2-      KFSGHPKGFAYIEFS------------------DKDSVR------TSMA-
A0A5F8HG85_BCL2L2-      KFSGHPKGFAYIEFS------------------DKDSVR------TSMA-
A0A5F8HG85_BCL2L2-      KFSGHPKGFAYIEFS------------------DKDSVR------TSMA-
A0A5F8GAQ2_MCL1-01      GITNWGRIVTLISFGAFVAKH--------LKSINQESCI------DPLAE
A0A5F8GAQ2_MCL1-02      GITNWGRIVTLISFGAFVAKH--------LKSINQESCI------DPLAE
A0A5F8GAQ2_MCL1-03      GITNWGRIVTLISFGAFVAKH--------LKSINQESCI------DPLAE
F6WA14_BCL2L1-01        DGVNWGRIVAFFSFGGALC----------VESVDKEMEVLV----GRITS
F6SFL4_BCL2A1-01        GVINWGRIVTIFAFGGIL-----------IKKLLRHRAPLTMGTQEEISH
F6VJQ0_BCL2L10-01       GEFNWGRVAVLVVFAGALLEMEELLKEEQVLQLRRETSRRL----TEK--
F6YNL8_BCL2-01          DGVNWGRIVAFFEFGGVMC----------VESVNREMSPLV----DSIAL
                           .. .  . . *.                   .               

A0A5F8HG85_BCL2L2-      -LDDSLFRGRQIKVIPKRTN-RPGISTTDRGFPRAR-----------YRA
A0A5F8HG85_BCL2L2-      -LDDSLFRGRQIKVIPKRTN-RPGISTTDRGFPRAR-----------YRA
A0A5F8HG85_BCL2L2-      -LDDSLFRGRQIKVIPKRTN-RPGISTTDRGFPRAR-----------YRA
A0A5F8GAQ2_MCL1-01      SITDVLVKTKRDWLIKQKGW-KGLLAQDTEEATRTGDPCAPSSAYLLLCA
A0A5F8GAQ2_MCL1-02      SITDVLVKTKRDWLIKQKGW-SGKERVDPRGLVSGG------------N-
A0A5F8GAQ2_MCL1-03      SITDVLVKTKRDWLIKQKGW-EGFVEFFHVQDLEGG------------IR
F6WA14_BCL2L1-01        WMATYLDDHLDPWIQENGGW-DTFVELYGNDAAAESRKGQERFNRWLLTG
F6SFL4_BCL2A1-01        FIAEFIMNNIAEWIRQNGGWENGFVKNFEPNTVWPNFTDISTKIWGIFSF
F6VJQ0_BCL2L10-01       -LCNYLVERKGAWLHENGGW-TGFHHHFEKRQSPPPSDSSNNTLCCIMAA
F6YNL8_BCL2-01          WMTEYLNRHLHTWIQDNGGW-VGA--------------------------
                         :   :      .:  :  .                              

A0A5F8HG85_BCL2L2-      RATNYSSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY------------
A0A5F8HG85_BCL2L2-      RATNYSSSRSRFYSGFNSRPRGRVYRGRARATSWFL--------------
A0A5F8HG85_BCL2L2-      RATNYSSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY------------
A0A5F8GAQ2_MCL1-01      EPLFWWCQLTASGCHVPDKPRNVLTEERKWAASLQRSHNKFSTSMITHGL
A0A5F8GAQ2_MCL1-02      --------------------------------------------------
A0A5F8GAQ2_MCL1-03      NVLLAFAGVAGVGAGLAYLIR-----------------------------
F6WA14_BCL2L1-01        MTVAGVVLLGSLFSRK----------------------------------
F6SFL4_BCL2A1-01        LK------------------------------------------------
F6VJQ0_BCL2L10-01       AAGFGLVGLALLLVVR----------------------------------
F6YNL8_BCL2-01          --------------------------------------------------
                                                                          

© 1998-2022Legal notice