Dataset for protein BCL-2-like of organism Meleagris gallopavo

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .  .:   :                                               :              
--------menrelvyvyy---------------------------a---svsssytsyvpqasrlvpa-----------
mahpgrrsysvgsiylsfvsyklsqrgydwseleerppvrtdtapt-rpd-slqgvpqwrlpvqhvrnlaavhrsslevh
      mgsdta flik ih     k hc aag dedenppal aegemcppgndslafh  egg g g           
               cd c                            aaa lacaaa e    e  c             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       :     . . .:       :  :  .: :.       .   *    * **  ****::::: **. :     .
----ttgvawvlrsagdel--ry-rafsqmlsqlhitpvtayqrfvq-VveelFsDGv-NWGRivtffsFGgvlcvesvs
eivrqsrlrqtspqlswsfsr--r--lrpltrrielksgevlksvfng mnhv r  nt    vmalit  alvtkklqn
    ppd hll  niasn qlqtqed agfsgk d  kfddhgaiee  aa k h           i e   fma h ke
    ag   ha  d     ed  e    d  d      e  a   ca       a                 a      d

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            :   :*  :      *:  :***:  *:  :               .   ::   :         : .
rems---vlvssiaywmTeylvshlrpWiqsnGGWe-gFvdly------e------s-rt-llsfatvagvlalgaylsr
qnvrltgpekgrlvtii taitrskhn lmeq   dnr ltkfgtsmrprvrksws-lnrwpmtlvlitdlitsvssmih
kgqq   kcieq ssf   nnn de  dd      a  ef  nnaaalleflqitiknvi agsg gaiglalfl g 
i  e   e  dn  g      id  aa   a                   fddgee f ks         cf      f 

   
...
   
k--
-yy
d  
   
© 1998-2021Legal notice