Dataset for protein BCL-2-like of organism Meleagris gallopavo

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1MPY7_MCL1-01        --------MEVGSLLCSFC---------------------------GRAC
G1N8C5_BCL2A1-01      --------METAEFYYVYY-------------------------------
G1MZW1_BCL2-01        MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPALAPTAAPA
G1N5N5_BCL2L1-01      ------MSSSNRELVIDFVSYKLSQKGHCWSELEEEDENRTDTAAEAEMD
                               .  .:   :                                

G1MPY7_MCL1-01        SSSCSVTAFRPQVQRLCPL---------------TGGLAWLSPSLSWNL-
G1N8C5_BCL2A1-01      -LAQDYLQYVLQESRLGPA---------------QTRVAHVLRNIASSLQ
G1MZW1_BCL2-01        PPGSAAASEVPPAEGLRPA---------------PPGVHLALRQAGDEFS
G1N5N5_BCL2L1-01      SVLNGSPSWHPPAGHVVNGAAVHRSSLEVHEIVRASDVRQTLRDAGDEFE
                                     :                     :     . . .: 

G1MPY7_MCL1-01        ------FSGMLRKLEIKKEEDLQAVCE-VAAHVFSDGVTNWGRVVTLISF
G1N8C5_BCL2A1-01      DQTEEALRPFLDRIDITSVDVAKRIFNGVMEEKFADGNTNWGRIMTIFTF
G1MZW1_BCL2-01        RRYQRDFAQMSGQLHLTPFTAHGRFVA-VVEELFRDGV-NWGRIVAFFEF
G1N5N5_BCL2L1-01      LRYRRAFSDLTSQLHITPGTAYQSFEQ-VVNELFHDGV-NWGRIVAFFSF
                            :  :  .: :.       .   *    * **  ****::::: *

G1MPY7_MCL1-01        GAFVAKHLKSINQE---KCISSLAGIITDALVSSKREWLMSQGGWE-GFV
G1N8C5_BCL2A1-01      GGLLTKKLQEQGVQLTGEEKEQISYFITEYIINNKAAWIDANGGWENGFL
G1MZW1_BCL2-01        GGVMCVESVNREMS---PLVDNIATWMTEYLNRHLHNWIQDNGGWD-AFV
G1N5N5_BCL2L1-01      GGALCVESVDKEMR---VLVGRIVSWMTTYLTDHLDPWIQENGGWE-RFV
                      *. :     .            :   :*  :      *:  :***:  *:

G1MPY7_MCL1-01        DFF------RVEDLESSIRNVLMAFAGVAGLGASLAYMIR---
G1N8C5_BCL2A1-01      TKF------E--------RRSPLSFSTITDIFAAVFSLFRDYY
G1MZW1_BCL2-01        ELYGTSMRPLFDFSWISLKT-ILSLVLVGACITLGAYLGHK--
G1N5N5_BCL2L1-01      DLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK--
                        :               .   ::   :         : .   

© 1998-2022Legal notice