Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------relv-dflsyklsq-g------------------------------------
mfglkrnaviglnlycgmmmtpaesgdn----v---qfg-k-k-yswsqlydveenrteapeggiftesemetpsaingn
                 gaamgcsaqytyrpaqryvm-vnrrnaviglnfsvgaatpgv  ap   ssqpgh  hpaasr
                   hldrmfpsitaiqakvigt-aqdtkpe dagd                             
                   gaeetgyklkp gnele-qm - r                                     
                       g ega    m   k   m                                       
                                g   h                                           
                                    a                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           .                                    
----vpgpgpgpgktgatl------v--------------defetrfrrcfsdlatq---tpgtayqlfeqvveelfrdg
pswhrgqapavnsa-arvpskvars-qpmaavkqalraagk-vsanykptlgevtsvlhvsidsvrtsattpsnrrvqrp
dpvklvdsrstersgshssqldmfeaisvyvphgrylete-nlnrhreiggdnmnvaigi-anasqpr-nr-mdke-eg-
 m aitslllqappa----rralsp r i  lgvtmgq arda lalqga---agak  gnvfr psaclkfdah-ka-a
    ccr  nasa-pmspehqmgdg p    gnld     e h k wh pvrs---h  l e d ti  s  ---v -f 
    s p    k vileiagp ead g                      m pk sig        kg  d   v p s  
    m      g    dd e    a                        d a  d              a   g   g  
                 a                                                              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-pnwgrivafft--------Fggalckesvnkem-plv----------------------ia-wma-ylerpladwirsn
ivpi-al-t--satparlff-eatriakllrr--e---sttdrgfpraryrarttnyyke--e---e-mnthtgpa-qqs
yi--s-eepiv-slaldfsv api-rvap-eqriqvdidr                 nssvsyfvvtfimnraee-ymep
v-ef d- -dra     e l ---v----pdetqasg gq                    rqasytav--dn---vlh--
 t    k sviv         r vqa vik--nns c ep                    l r isg nva-rrt  -kr
         l e           rm  h  ti  r    n                      l   d  s-tkhr  vgq
                       f      k                                               d 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----ggwd----------------tfvelyg------sr-gqer------------------------------------
eeeld-yepeplgkrpavleeeaepl-----nsaaae--k--l-fnpppaeeepvimsiedelyrqsleiisrylreqat
    -r-tl aika vrem     k-lvfvnengnspktrns-pstfswlsag       ekmeadars yvgnvdyg  
    r ag                sgta qhvgmleggvdlrplms   gn                             
    a  a                n k  f ped   akfkvms d                                  
                        g f    d      ieepkn                                    
                        e                  g                                    
                        a                                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gakdtkpmgrsgatsrkaletlrrvghpkgfayiefsdkdgvqrnlalhetafqgwvrkvdiknedivkstsrvmvsvts
aeeleahfhgc svn vtilcdkfs              es rts   d sl r rqigl      dp rln pgihtpd
                                                       mlc                   lfc
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------rwfltg----g-v-lgsl---k----------
rgvtrwryrvtttsynssvsrhystinsrscirvyrrsiwsvlvrtkr-tysvymvva-v-l----fsr-mglrsvllaf
d prnagriarlinfgafrakflkgf qqprgeplcgrctd      tsfl-plttwgkliesvaylkvygfiank    
  fp                       hek aagfaecara      ln av--rmttaicymlrvvtqgcaf       
                                                k mtsrplld fatfihhrglea         
                                                g hnkqggg  c a f  edk           
                                                d  ghme    a        h           
                                                a   faa                         

       490     
....:....|....:
               
---------------
agvagvsnklaylir
     igagi l   
               
               
               
               
               
© 1998-2022Legal notice