Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------r--v----gykl-q-gy----------------------------------------------------
mmatpassqmn-ll-ndfi----y-k--glgagsggatppggrllptekplsqrrrigggefgtvirrtfsdsppqllvt
 ahagrmapdfgekrvavvsln scg avc   p eg        aaadeahaameaa d ae rfggsagalaaaahtp
      tgyst ai akylh   r r  s                                                   
               m            e                                                   
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pgsrvqrptqvsdevpqvtptwgrlvfffvtrralplesvnkpmeplvmsvqewmvgylptrlgkwpavlpllelvgews
daraqa fppiga lfdgganpa  fa apfga aca emeaeaadaigqpe elda eeep adri           sg
                                                                              h 
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------teeeae-lyrl--e-----l-spapgnatsk-ssmgrkgatsrra----------v-tlrrvgg-
ssswveesrtstppga-----yp-e-sq-pswhy-r----nsgptvt-pl--s----ak-gpalspvppv-e-glv-adg
qgpstdgnlpeagep-dsvmgt-s-qqnnylsyvvqiqqv-gkgphsm--lq-vvip-as          lyv---e--a
nfgdel ftklyvrmmpc fdkikainldviqrmnmeaptra-dg-ikrveermefdvqt          ikqan dylr
    a  digdv de lg ere rifagqiekqlpdp  sa-wa-r   idape aam-            lmwk tl  
       aaaar aa     pr g   s  g  t h     tp-kd    pt a p               hlta q   
                     a                   d va                               a   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--reletrfrgcl--l--qs-dtvgtl-qsf--mvheffrgginwgrivt-fs--------fvgk-ikvl--rica----
vqknh-rayqrm-sn-ts--h--p--ay-rveq----l-dd-v-------f--fgallcve----e---ivsq-a-pgvs
tad-fslnlkpafrkvnvklvnr-ts-fs--atvgnv-s--y-efsdkeavrtslgadeslsrdrqmqt-pr-t-repld
pvegvnkh-h--vddmdigniidari cnq   sekpkgfavtr     slia   vm    eaillsk nqesniadia
l td- a-w- w ps sta el  k  rdk     elpe  ir       i e          n h  p lknril  fc
      -    p cg a h     f   g         c  p                             h k      
           d ae                                                        d        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------r------------fv-----n----------rf-------------wfltg------v--------k--
ttwmgvylnrh-erwiqynggwst--elygn-aagesrrgre--nsswvslrepksgtlvsymtvagv-elgslfsr-gg
esitdtpvrtyldpttneyserdy ysgfnsrptarwykqqggwtrgflkkk     fyspqrgwgkfilffhvlklema
rcdraflradk at   d ksi r  ae imsnr  vi  nalagn     f      m-klpvtdalctsvayedqyc 
  cwte      s        q a      p m        p vek            ht--em   i  ml hrgk   
    s       h                               df             nhmal   c        h   
                                             a             afk                  

       410       420   
....:....|....:....|...
                       
-----------------------
irnvllafagvagvgaglaylir
l            isnki l   
                       
                       
                       
                       
© 1998-2023Legal notice