Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------t----pdtrrlvqdylgyklr-----qkgy--gag-g------------------
mfglkrnaviglnlycggaglgmmm-patf-ynyl-aa-fvq-v-seigggipq-vw---s-gatppgvaplatrvtstp
                      agaggcsag-i-ek--k-i-s-rq     ---tscsqspvvsptrtltleprifsrsk
                       asadresys-gairvev-sln -     er agldgfddaeenaagr dgggakeqe
                        h   mpqmg -  takeh a y     cg  ei   a   a   e  a    adp 
                             g gf    n   a          a                           
                                     m                                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----g----k---------------------------------------------------------------------
pmtps-sgss-twartssrpvtgatapssspeapavdpvmspeeeldgyepeplgkrpavlpllelvgesgnspstdgsl
migrpvpaprpsvklvgppatprrpghlegmdlspapam                                         
gh aepatvtdpph lfll qna a aaaelagre i l                                         
 e  haingnam    dff pk                i                                         
       dad                                                                      
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                           ..      .     :      
-------------------------------------------------hqtlrrvgdevqrryrrafsdmlsqlhvtpg
pstpppaeeeedelyrqsleiisrylreqatgakdtkpmgrsgatsrkvsramqkaafsfetnvettlqplarnvniksi
                                              aatlev--a---glskeh knvkgctdk-d-ane
                                                a---  -   - nl f pp ps sah -l- f
                                                lkl   q   d    w  d ae  t       
                                                      e                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      :  *    * .*  ****:*::: * . :            :         :.  :      *: .. **    
dayqs-ftqVmeelFrdG-vNWGRiVaffsFggalckesvnkemeplvdtiae---wmaeylnrhlrdWiqsngGWd---
ttvrrllsr vvkv sg vt    l tliv eaivivklltqrqqvdisryqaisysvttvivtttgp lvqsr  elea
sdqkt  nt snhe q  ip       i a   fmaah kriniasc gqvkl   fivdf mnrkee  rkq   g   
  ag     d   e   i         e   v      dr  s   epl         edn at  h   a   
  r                                            n                h           
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------g-fvel-ygveal-------eg---
ikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvtg---fgfhp---eesrkgrgsfnf
                                                       n ntk- --nndaaahfrlq-rvr 
                                                       k   dy at-sm   a h cp-id 
                                                       e   ak  edge        kl   
                                                       a        a               
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     :                                                          
-----rwllvlmvvagvvllgall--k-----------------------------------------------------
swlslnvfntgatfg-lpeglsyfsrgmaysirtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnyn
     gtttsrtm--kiiavv --kv-lkllvk                                               
     -irslmplttahgtsf hvtqydffas                                                
     k mihflkls cckm   rgksc e                                                  
       h fceg   aag    ieh a                                                    
       a a da            f                                                      

       490       500       510  
....:....|....:....|....:....|..
                                
--------------------------------
ssrsrfysgfnsrprgrvyrgraratswyspy
                                
                                
                                
                                
                                
© 1998-2020Legal notice