Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6AI25_BCL2L2-      ------------------MATPASAPDTRALVADFVGYKLRQKG------
A0A2K5XSB2_MCL1-02      ------------------------------------MFGLKRNAVIGLNL
A0A2K5XSB2_MCL1-01      ------------------------------------MFGLKRNAVIGLNL
A0A2K5XRD4_BCL2-01      -----------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAG
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      -----------------------MSQSNRELVVDFLSYKLSQKGYSWSQF
A0A2K5YR37_BCL2L1-      -----------------------MSQSNRELVVDFLSYKLSQKGYSWSQF
A0A2K5XSB2_MCL1-03      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTKP-----
A0A2K6AI25_BCL2L2-      ------------------MATPASAPDTRALVADFVGYKLRQKGY-----
A0A2K6AI25_BCL2L2-      --------------------MEEEAEKLKELQNEVEKQMNM---------
A0A2K6AD27_BCL2A1-      -------------------MTDCEFGYIYRLAQDYLQYVLQ---------
A0A2K6AD27_BCL2A1-      -------------------MTDCEFGYIYRLAQDYLQYVLQ---------
                                                                          

A0A2K6AI25_BCL2L2-      Y---------------------------------VCGAGPGEGP-AADP-
A0A2K5XSB2_MCL1-02      Y---------------------------------CGGAGLGAGSGGATP-
A0A2K5XSB2_MCL1-01      Y---------------------------------CGGAGLGAGSGGATP-
A0A2K5XRD4_BCL2-01      DVGAATPGVAPAPGIFSSQPGHTPHPAASRDPVARTSPLPTPAAPAAAAG
A0A2K5YR37_BCL2L1-      -------------------------------MWKRTGLRPQKG-------
A0A2K5YR37_BCL2L1-      SDVEENRTEAPEG---TESEMETPSAINGNPSWHLVDSPAVNGATGHSSS
A0A2K5YR37_BCL2L1-      SDVEENRTEAPEG---TESEMETPSAINGNPSWHLVDSPAVNGATGHSSS
A0A2K5XSB2_MCL1-03      ----------------------------------MGRSGATSRKALETLR
A0A2K6AI25_BCL2L2-      ----------------------------------VCGAGPGEGPAADPLH
A0A2K6AI25_BCL2L2-      ----------------------------------SPPPGNAGPVIMSIEE
A0A2K6AD27_BCL2A1-      ----------------------------------IPQPGSGPSKTSRVLQ
A0A2K6AD27_BCL2A1-      ----------------------------------IPQPGSGPSKTSRVLQ
                                                                          

A0A2K6AI25_BCL2L2-      -----------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
A0A2K5XSB2_MCL1-02      -----------PGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAAL
A0A2K5XSB2_MCL1-01      -----------PGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAAL
A0A2K5XRD4_BCL2-01      PALSPVPPV--VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFA
A0A2K5YR37_BCL2L1-      ----------------------LNRRWRPPVPSMATH----PGTAYQSFE
A0A2K5YR37_BCL2L1-      LDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
A0A2K5YR37_BCL2L1-      LDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
A0A2K5XSB2_MCL1-03      RVGDGVQ-------------RNHETAFQGMLRKLDIK---NEDDVKSL-S
A0A2K6AI25_BCL2L2-      QAMRAAG-------------DEFETRFRRTFSDLAAQLHVTPGSAQQRFT
A0A2K6AI25_BCL2L2-      KMEADARSIYVGNVDYGATAEELEAHFHGC------G---SVNRVTILCD
A0A2K6AD27_BCL2A1-      KVAFSVQ-------------KEVEKNLKPCLDNVNVA---SIDTARTLFN
A0A2K6AD27_BCL2A1-      KVAFSVQ-------------KEVEKNLKPCLDNVNVA---SIDTARTLFN
                                               .                          

A0A2K6AI25_BCL2L2-      QVSDELFQGG-PNWGRLVA--------FFVFGAALCAESVNKEMEPLVGQ
A0A2K5XSB2_MCL1-02      TPDARRVARP-PPIGAEVPDVTATPARLFFFAPTRRAAPLEE--------
A0A2K5XSB2_MCL1-01      TPDARRVARP-PPIGAEVPDVTATPARLFFFAPTRRAAPLEE--------
A0A2K5XRD4_BCL2-01      TVVEELFRDG-VNWGRIVAFFE--------FGGVMCVESVNREMSPLVDN
A0A2K5YR37_BCL2L1-      QVVNELFRDG-VNWGRIVAFFS--------FGGALCVESVDKEMQVLVSR
A0A2K5YR37_BCL2L1-      Q-------------------------------------------------
A0A2K5YR37_BCL2L1-      QVVNELFRDG-VNWGRIVAFFS--------FGGALCVESVDKEMQVLVSR
A0A2K5XSB2_MCL1-03      RVMVHVFSDGVTNWGRIVTLIS--------FGAFVAKHLKTINQESCIEP
A0A2K6AI25_BCL2L2-      QVSDELFQGG-PNWGRLVAFFV--------FGAALCAESVNKEMEPLVGQ
A0A2K6AI25_BCL2L2-      KFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIST
A0A2K6AD27_BCL2A1-      QVMEKEFEDGIINWGRIVTIFA--------FEGILIKKLLRQRIAPDVDT
A0A2K6AD27_BCL2A1-      QVMEKEFEDGIINWGRIVTIFA--------FEGILIKKLLRQRIAPDVDT
                                                                          

A0A2K6AI25_BCL2L2-      --------------------VQEWMVAYLETRLADWIHSS----GGWELE
A0A2K5XSB2_MCL1-02      ----------------------------MEAPAADAIMSPEEELDGYEPE
A0A2K5XSB2_MCL1-01      ----------------------------MEAPAADAIMSPEEELDGYEPE
A0A2K5XRD4_BCL2-01      --------------------IALWMTEYLNRHLHTWIQDN----GGWD--
A0A2K5YR37_BCL2L1-      --------------------IAAWMATYLNDHLEPWIQEN----GGWD--
A0A2K5YR37_BCL2L1-      -----------------------------------------------D--
A0A2K5YR37_BCL2L1-      --------------------IAAWMATYLNDHLEPWIQEN----GGWD--
A0A2K5XSB2_MCL1-03      --------------------LAESITDVLVRTKRDWLVKQ----RGWD--
A0A2K6AI25_BCL2L2-      --------------------VQEWMVAYLETRLADWIHSS----GGWA--
A0A2K6AI25_BCL2L2-      TDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGR----ARAT--
A0A2K6AD27_BCL2A1-      -----------------YKEISYFVAEFIMNNTGEWIRQN----GGWE--
A0A2K6AD27_BCL2A1-      -----------------YKEISYFVAEFIMNNTGEWIRQN----GGWG--
                                                                          

A0A2K6AI25_BCL2L2-      AIKARVREMEEEAEKLKELQNE------VEKQMNMSPPPGNAGPVIMSIE
A0A2K5XSB2_MCL1-02      PLGKRPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------E
A0A2K5XSB2_MCL1-01      PLGKRPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------E
A0A2K5XRD4_BCL2-01      --------------AFVELYGPSM-------RPLFDFSWLS---------
A0A2K5YR37_BCL2L1-      --------------TFVELYGNNAAAESRKGQERFN--------------
A0A2K5YR37_BCL2L1-      --------------TFVELYGNNAAAESRKGQERFN--------------
A0A2K5YR37_BCL2L1-      --------------TFVELYGNNAAAESRKGQERFN--------------
A0A2K5XSB2_MCL1-03      --------------GFVEFFHVEDLEGGIRNVLL----------------
A0A2K6AI25_BCL2L2-      --------------EFTALYGDGALEEARRLREG----------------
A0A2K6AI25_BCL2L2-      --------------S-----------------------------------
A0A2K6AD27_BCL2A1-      --------------NGFV---------KKFEPKS----------------
A0A2K6AD27_BCL2A1-      --------------K-----------------------------------
                                                                          

A0A2K6AI25_BCL2L2-      EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKG
A0A2K5XSB2_MCL1-02      DELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG----
A0A2K5XSB2_MCL1-01      DELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG----
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6AI25_BCL2L2-      FAYIEFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRPGISTTD
A0A2K5XSB2_MCL1-02      ---------DGVQRN---HETAFQGWVCGV-----------------LPC
A0A2K5XSB2_MCL1-01      ---------DGVQRN---HETAFQGMLRKLDIKNEDDVKSLSRVMVHVFS
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K6AI25_BCL2L2-      RGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSW
A0A2K5XSB2_MCL1-02      RGPRRW---------------------HQKCAAGFCRCCWS------RSW
A0A2K5XSB2_MCL1-01      DGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDW
A0A2K5XRD4_BCL2-01      -----------------------------------------------LKT
A0A2K5YR37_BCL2L1-      ------------------------------------------------RW
A0A2K5YR37_BCL2L1-      ------------------------------------------------RW
A0A2K5YR37_BCL2L1-      ------------------------------------------------RW
A0A2K5XSB2_MCL1-03      ------------------------------------------------AF
A0A2K6AI25_BCL2L2-      ------------------------------------------------NW
A0A2K6AI25_BCL2L2-      -------------------------------------------------W
A0A2K6AD27_BCL2A1-      ------------------------------------------------GW
A0A2K6AD27_BCL2A1-      -------------------------------------------------W
                                                                          

A0A2K6AI25_BCL2L2-      YSPY-----------------------------------------
A0A2K5XSB2_MCL1-02      F---------------------------------GISNKIALL--
A0A2K5XSB2_MCL1-01      LVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
A0A2K5XRD4_BCL2-01      LLSLALVGACITLGAYLGHK-------------------------
A0A2K5YR37_BCL2L1-      FLTGMTVAGVVLLGSLFSRK-------------------------
A0A2K5YR37_BCL2L1-      FLTGMTVAGVVLLGSLFSRK-------------------------
A0A2K5YR37_BCL2L1-      FLTGMTVAGVVLLGSLFSRK-------------------------
A0A2K5XSB2_MCL1-03      AGVAGVGAGLAYLIR------------------------------
A0A2K6AI25_BCL2L2-      ASVRTVLTGAVALGALVTVGAFFASK-------------------
A0A2K6AI25_BCL2L2-      YSPY-----------------------------------------
A0A2K6AD27_BCL2A1-      MTFLEVTGKICEMLSLLKQYC------------------------
A0A2K6AD27_BCL2A1-      HNHMPM---LVESVAHRKKKMAL----------------------
                                                                     

© 1998-2022Legal notice