Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      ------MFGLKRNAVIGLNLYCGG--------------------------
A0A2K5YR37_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKG------YSWSQFSDVEENRTEAP
A0A2K6AI25_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------Y----------------
A0A2K6AI25_BCL2L2-      ---MEEEAEKLKELQNEVEKQMNM--------------------------
A0A2K6AD27_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ--------------------------
A0A2K6AD27_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ--------------------------
A0A2K5XRD4_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRG------YEW--------DAGDVG
A0A2K5YR37_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKG------YSWSQFSDVEENRTEAP
A0A2K6AI25_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YV---------CGAGPG
A0A2K5XSB2_MCL1-02      -------------------MFGLKRNAVIGLNLYC---------GGAGLG
A0A2K5XSB2_MCL1-01      -------------------MFGLKRNAVIGLNLYC---------GGAGLG
                                                                          

A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      -------------AGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRK
A0A2K5YR37_BCL2L1-      EGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQ
A0A2K6AI25_BCL2L2-      -----------------------VCGAGPGEGPAADPLHQAMRAAG----
A0A2K6AI25_BCL2L2-      -----------------------SPPPGNAGPVIMSIEEKMEADARSIYV
A0A2K6AD27_BCL2A1-      -----------------------IPQPGSGPSKTSRVLQKVAFSVQ----
A0A2K6AD27_BCL2A1-      -----------------------IPQPGSGPSKTSRVLQKVAFSVQ----
A0A2K5XRD4_BCL2-01      AATPGVAPAPGIFSSQPG-HTPHPAASRDPVARTSPLPTPAAPAAAAGPA
A0A2K5YR37_BCL2L1-      EGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---
A0A2K6AI25_BCL2L2-      EGP-AADP------------------------------------------
A0A2K5XSB2_MCL1-02      AGSGGATP------------------------------------------
A0A2K5XSB2_MCL1-01      AGSGGATP------------------------------------------
                                                                          

A0A2K5YR37_BCL2L1-      ----------MWKRTGLRPQKGLNRRWRPPVPSMATHPGTAYQSFEQVVN
A0A2K5XSB2_MCL1-03      -------ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMV
A0A2K5YR37_BCL2L1-      -------ALREAG---DEFELRYRRAFSDLTSQLHITPGTAYQSFEQ---
A0A2K6AI25_BCL2L2-      ----------------DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSD
A0A2K6AI25_BCL2L2-      -------GNVDYGATAEELEAHFHGC------G---SVNRVTILCDKFSG
A0A2K6AD27_BCL2A1-      ----------------KEVEKNLKPCLDNVNVA---SIDTARTLFNQVME
A0A2K6AD27_BCL2A1-      ----------------KEVEKNLKPCLDNVNVA---SIDTARTLFNQVME
A0A2K5XRD4_BCL2-01      LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVE
A0A2K5YR37_BCL2L1-      -------VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVN
A0A2K6AI25_BCL2L2-      -------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSD
A0A2K5XSB2_MCL1-02      -------PGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDA
A0A2K5XSB2_MCL1-01      -------PGGRLLATEKEASARREIGGGEAGTVIGGSAGASPPAALTPDA
                                           .                              

A0A2K5YR37_BCL2L1-      ELFRDG-VNWGRIVA--------FFSFGGALCVESVDKEMQVLVSR----
A0A2K5XSB2_MCL1-03      HVFSDGVTNWGRIVTLIS--------FGAFVAKHLKTINQESCIEP----
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      ELFQGG-PNWGRLVAFFV--------FGAALCAESVNKEMEPLVGQ----
A0A2K6AI25_BCL2L2-      HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRG
A0A2K6AD27_BCL2A1-      KEFEDGIINWGRIVTIFA--------FEGILIKKLLRQRIAPDVDT----
A0A2K6AD27_BCL2A1-      KEFEDGIINWGRIVTIFA--------FEGILIKKLLRQRIAPDVDT----
A0A2K5XRD4_BCL2-01      ELFRDG-VNWGRIVA--------FFEFGGVMCVESVNREMSPLVDN----
A0A2K5YR37_BCL2L1-      ELFRDG-VNWGRIVA--------FFSFGGALCVESVDKEMQVLVSR----
A0A2K6AI25_BCL2L2-      ELFQGG-PNWGRLVA--------FFVFGAALCAESVNKEMEPLVGQ----
A0A2K5XSB2_MCL1-02      RRVARP-PPIGAEVPDVTATPARLFFFAPTRRAAPLEE------------
A0A2K5XSB2_MCL1-01      RRVARP-PPIGAEVPDVTATPARLFFFAPTRRAAPLEE------------
                                                                          

A0A2K5YR37_BCL2L1-      ----------------IAAWMATYLNDHLEPWIQEN----GGWD------
A0A2K5XSB2_MCL1-03      ----------------LAESITDVLVRTKRDWLVKQ----RGWD------
A0A2K5YR37_BCL2L1-      -----------------DTFVELYGNNAAAESRKGQ----ERFN------
A0A2K6AI25_BCL2L2-      ----------------VQEWMVAYLETRLADWIHSS----GGWA------
A0A2K6AI25_BCL2L2-      FPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGR----ARAT------
A0A2K6AD27_BCL2A1-      -------------YKEISYFVAEFIMNNTGEWIRQN----GGWG------
A0A2K6AD27_BCL2A1-      -------------YKEISYFVAEFIMNNTGEWIRQN----GGWE------
A0A2K5XRD4_BCL2-01      ----------------IALWMTEYLNRHLHTWIQDN----GGWD------
A0A2K5YR37_BCL2L1-      ----------------IAAWMATYLNDHLEPWIQEN----GGWD------
A0A2K6AI25_BCL2L2-      ----------------VQEWMVAYLETRLADWIHSS----GGWELEAIKA
A0A2K5XSB2_MCL1-02      ------------------------MEAPAADAIMSPEEELDGYEPEPLGK
A0A2K5XSB2_MCL1-01      ------------------------MEAPAADAIMSPEEELDGYEPEPLGK
                                                                          

A0A2K5YR37_BCL2L1-      ----------TFVELYGN--------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      ----------AFVELYGP--------------------------------
A0A2K5YR37_BCL2L1-      ----------TFVELYGN--------------------------------
A0A2K6AI25_BCL2L2-      RVREMEEEAEKLKELQNE------VEKQMNMSPPPGNAGPVIMSIEEKME
A0A2K5XSB2_MCL1-02      RPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------EDELY
A0A2K5XSB2_MCL1-01      RPAVL-----PLLELVGESGNSPSTDGSLPSTPPPAEEE------EDELY
                                                                          

A0A2K5YR37_BCL2L1-      ------------NAAAESRKGQERFN------RWFLTGMTVA--------
A0A2K5XSB2_MCL1-03      ------------GFVEFFHVEDLEGGIRNVLLAFAGVAGVGA--------
A0A2K5YR37_BCL2L1-      ------------R--------------------WFLTGMTVA--------
A0A2K6AI25_BCL2L2-      ------------EFTALYGDGALEEARRLREGNWASVRTVLT--------
A0A2K6AI25_BCL2L2-      ------------S--------------------WYSPY------------
A0A2K6AD27_BCL2A1-      ------------K--------------------WHNHMPM----------
A0A2K6AD27_BCL2A1-      ------------NGFV---------KKFEPKSGWMTFLEVTG--------
A0A2K5XRD4_BCL2-01      ------------SM-------RPLFDFSWLSLKTLLSLALVG--------
A0A2K5YR37_BCL2L1-      ------------NAAAESRKGQERFN------RWFLTGMTVA--------
A0A2K6AI25_BCL2L2-      ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYI
A0A2K5XSB2_MCL1-02      RQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG--------
A0A2K5XSB2_MCL1-01      RQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVG--------
                                                                          

A0A2K5YR37_BCL2L1-      --------------GVVLLGSLFSRK------------------------
A0A2K5XSB2_MCL1-03      --------------GLAYLIR-----------------------------
A0A2K5YR37_BCL2L1-      --------------GVVLLGSLFSRK------------------------
A0A2K6AI25_BCL2L2-      --------------GAVALGALVTVGAFFASK------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      ---------------LVESVAHRKKKMAL---------------------
A0A2K6AD27_BCL2A1-      --------------KICEMLSLLKQYC-----------------------
A0A2K5XRD4_BCL2-01      --------------ACITLGAYLGHK------------------------
A0A2K5YR37_BCL2L1-      --------------GVVLLGSLFSRK------------------------
A0A2K6AI25_BCL2L2-      EFSDKESVRTSLALDESLFRGRQIKV------IPKRTNRPGISTTDRGFP
A0A2K5XSB2_MCL1-02      -----DGVQRN---HETAFQGWVCGV-----------------LPCRGPR
A0A2K5XSB2_MCL1-01      -----DGVQRN---HETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVT
                                                                          

A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      RARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARA------TSWYSPY
A0A2K5XSB2_MCL1-02      RW---------------------HQKCAAGFCRCCWS------RSWF---
A0A2K5XSB2_MCL1-01      NWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQ
                                                                          

A0A2K5YR37_BCL2L1-      -----------------------------------------
A0A2K5XSB2_MCL1-03      -----------------------------------------
A0A2K5YR37_BCL2L1-      -----------------------------------------
A0A2K6AI25_BCL2L2-      -----------------------------------------
A0A2K6AI25_BCL2L2-      -----------------------------------------
A0A2K6AD27_BCL2A1-      -----------------------------------------
A0A2K6AD27_BCL2A1-      -----------------------------------------
A0A2K5XRD4_BCL2-01      -----------------------------------------
A0A2K5YR37_BCL2L1-      -----------------------------------------
A0A2K6AI25_BCL2L2-      -----------------------------------------
A0A2K5XSB2_MCL1-02      ------------------------------GISNKIALL--
A0A2K5XSB2_MCL1-01      RGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                                                                 

© 1998-2022Legal notice