Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5XSB2_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A2K6AI25_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
A0A2K5XRD4_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLS----
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLS----
A0A2K6AD27_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQ----
A0A2K6AD27_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQ----
A0A2K5XSB2_MCL1-03      -------------------------------MFGLKRNAVIGLNLY----
A0A2K6AI25_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLR----
                                                                          

A0A2K5XSB2_MCL1-01      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARLFFFA
A0A2K6AI25_BCL2L2-      -QKGYVCGAGPG--------------------------------------
A0A2K5XRD4_BCL2-01      -QRGYEWDAGDVGAATPGVAPAPGIFSSQPGHTPHPAASRDPVARTSPLP
A0A2K5YR37_BCL2L1-      -----------------------------------------MWKRTGLRP
A0A2K5YR37_BCL2L1-      -QKGYSWSQFSDVEENRTEAPEG---TESEMETPSAINGNPSWHLVDSPA
A0A2K6AD27_BCL2A1-      -IPQ------------------------------PGSGPSK---------
A0A2K6AD27_BCL2A1-      -IPQ------------------------------PGSGPSK---------
A0A2K5XSB2_MCL1-03      -CGGAGLGAGSGGATPPGGRLLATGAKDTKPMGRSGATSRK---------
A0A2K6AI25_BCL2L2-      -QKGYVCGAGPG----------------------EGPAADP---------
                                                                          

A0A2K5XSB2_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A2K6AI25_BCL2L2-      -----------EGPAADPL-------------------------------
A0A2K5XRD4_BCL2-01      TPAAPAAAAGPALSPVPPV-------------------------------
A0A2K5YR37_BCL2L1-      QKG-----------------------------------------------
A0A2K5YR37_BCL2L1-      VNGATGHSSSLDAREVIPM-------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5XSB2_MCL1-01      GNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5XSB2_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
A0A2K6AI25_BCL2L2-      ---------HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQV
A0A2K5XRD4_BCL2-01      --------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATV
A0A2K5YR37_BCL2L1-      -------------------LNRRWRPPVPSMATH----PGTAYQS-FEQV
A0A2K5YR37_BCL2L1-      ------AAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQV
A0A2K6AD27_BCL2A1-      --------TSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQV
A0A2K6AD27_BCL2A1-      --------TSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQV
A0A2K5XSB2_MCL1-03      --------ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRV
A0A2K6AI25_BCL2L2-      --------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQV
                                           ..      .     :            :  *

A0A2K5XSB2_MCL1-01      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAE---SITD
A0A2K6AI25_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQE---WMVA
A0A2K5XRD4_BCL2-01      VEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL---WMTE
A0A2K5YR37_BCL2L1-      VNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA---WMAT
A0A2K5YR37_BCL2L1-      VNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAA---WMAT
A0A2K6AD27_BCL2A1-      MEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAE
A0A2K6AD27_BCL2A1-      MEKEFEDGIINWGRIVTIFAFEGILIKKLLRQRIAPDVDTYKEISYFVAE
A0A2K5XSB2_MCL1-03      MVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAE---SITD
A0A2K6AI25_BCL2L2-      SDELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQE---WMVA
                            * .*  ****:*::: * . :            :         :. 

A0A2K5XSB2_MCL1-01      VLVRTKRDWLVKQRGWD---------------------------------
A0A2K6AI25_BCL2L2-      YLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSP
A0A2K5XRD4_BCL2-01      YLNRHLHTWIQDNGGWD---------------------------------
A0A2K5YR37_BCL2L1-      YLNDHLEPWIQENGGWD---------------------------------
A0A2K5YR37_BCL2L1-      YLNDHLEPWIQENGGWD---------------------------------
A0A2K6AD27_BCL2A1-      FIMNNTGEWIRQNGGWE---------------------------------
A0A2K6AD27_BCL2A1-      FIMNNTGEWIRQNGGWG---------------------------------
A0A2K5XSB2_MCL1-03      VLVRTKRDWLVKQRGWD---------------------------------
A0A2K6AI25_BCL2L2-      YLETRLADWIHSSGGWA---------------------------------
                         :      *: .. **                                  

A0A2K5XSB2_MCL1-01      -------------------------G-FVEF-FHVEDLE------GGIR-
A0A2K6AI25_BCL2L2-      PPGNAGPVIMSIEEKMEADARSIYVG-NVDYGATAEELEAHFHGCGSVN-
A0A2K5XRD4_BCL2-01      -------------------------A-FVEL-YGPSM-------RPLFDF
A0A2K5YR37_BCL2L1-      -------------------------T-FVEL-YGNNAAAESRKGQERFN-
A0A2K5YR37_BCL2L1-      -------------------------T-FVEL-YGNNAAAESRKGQERFN-
A0A2K6AD27_BCL2A1-      -------------------------NGFVKK-FEP----------KS---
A0A2K6AD27_BCL2A1-      -------------------------K------------------------
A0A2K5XSB2_MCL1-03      -------------------------G-FVEF-FHVEDL-------EG---
A0A2K6AI25_BCL2L2-      -------------------------E-FTAL-YGDGALEEARRLREG---
                                                                          

A0A2K5XSB2_MCL1-01      -----NVLLAFAGVAGVGAGLAYL-------IR-----------------
A0A2K6AI25_BCL2L2-      -----RVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKV
A0A2K5XRD4_BCL2-01      SWLSLKTLLSLALVGACITLGAYLGHK-----------------------
A0A2K5YR37_BCL2L1-      -----RWFLTGMTVAGVVLLGSLFSRK-----------------------
A0A2K5YR37_BCL2L1-      -----RWFLTGMTVAGVVLLGSLFSRK-----------------------
A0A2K6AD27_BCL2A1-      -----GWMTFLEVTGKICEMLSLLKQYC----------------------
A0A2K6AD27_BCL2A1-      ------WHNHMPM---LVESVAHRKKKMAL--------------------
A0A2K5XSB2_MCL1-03      -----GIRNVLLAFAGVAGVGA----GLAYLIR-----------------
A0A2K6AI25_BCL2L2-      -----NWASVRTVLTGAVALGALVTVGAFFASK-----------------
                                             :                            

A0A2K5XSB2_MCL1-01      --------------------------------------------------
A0A2K6AI25_BCL2L2-      IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYR
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5XSB2_MCL1-01      ------------
A0A2K6AI25_BCL2L2-      GRARATSWYSPY
A0A2K5XRD4_BCL2-01      ------------
A0A2K5YR37_BCL2L1-      ------------
A0A2K5YR37_BCL2L1-      ------------
A0A2K6AD27_BCL2A1-      ------------
A0A2K6AD27_BCL2A1-      ------------
A0A2K5XSB2_MCL1-03      ------------
A0A2K6AI25_BCL2L2-      ------------
                                    

© 1998-2020Legal notice