Dataset for protein BCL-2-like of organism Mandrillus leucophaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYE---------------------
A0A2K5YR37_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYS---------------------
A0A2K5XSB2_MCL1-03      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL-----
A0A2K5YR37_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYS---------------------
A0A2K5XSB2_MCL1-02      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K5XSB2_MCL1-01      ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEG--------PAADP
A0A2K6AI25_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEG--------PAADP
                                                                          

A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-02      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A2K5XSB2_MCL1-01      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP
A0A2K6AI25_BCL2L2-      LHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP
                                                                          

A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XSB2_MCL1-02      TPARLFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K5XSB2_MCL1-01      TPARLFFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AD27_BCL2A1-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWI---
A0A2K6AI25_BCL2L2-      NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWI---
                                                                          

A0A2K5YR37_BCL2L1-      --------------------------------------------------
A0A2K5XRD4_BCL2-01      --------W--------DAGDVGAATPGVAPAPGIFSSQPG-HTPHPAAS
A0A2K5YR37_BCL2L1-      --------WSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAV
A0A2K5XSB2_MCL1-03      --------------------------------------------------
A0A2K5YR37_BCL2L1-      --------WSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAV
A0A2K5XSB2_MCL1-02      PLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
A0A2K5XSB2_MCL1-01      PLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
A0A2K6AI25_BCL2L2-      -------------------------MEEEAEKLKELQNEVEKQMNMSPPP
A0A2K6AD27_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQIPQP
A0A2K6AD27_BCL2A1-      ------------------------MTDCEFGYIYRLAQDYLQYVLQIPQP
A0A2K6AI25_BCL2L2-      --------HSSGGWA-EFTALYGDGALEEARRLRE---------------
A0A2K6AI25_BCL2L2-      --------HSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPP
                                                                          

A0A2K5YR37_BCL2L1-      --------------------------------MWKRTGLRPQKGLNRRWR
A0A2K5XRD4_BCL2-01      RDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQAG---DDFSRRYR
A0A2K5YR37_BCL2L1-      NGATGHSSSLDAREVIPMAA----------VKQALREAG---DEFELRYR
A0A2K5XSB2_MCL1-03      ATGAKDTKPMGRSGATSRKA----------LETLRRVGDGVQRNHETAFQ
A0A2K5YR37_BCL2L1-      NGATGHSSSLDAREVIPMAA----------VKQALREAG---DEFELRYR
A0A2K5XSB2_MCL1-02      GAKDTK--PMGRSGATSRKA----------LETLRRVGDGVQRNHETAFQ
A0A2K5XSB2_MCL1-01      GAKDTK--PMGRSGATSRKA----------LETLRRVGDGVQRNHETAFQ
A0A2K6AI25_BCL2L2-      GNAGPVIMSIEEKMEADARS----------IYVGNVDYGATAEELEAHFH
A0A2K6AD27_BCL2A1-      GSGPSKTSRVLQKVAFSVQ-----------------------KEVEKNLK
A0A2K6AD27_BCL2A1-      GSGPSKTSRVLQKVAFSVQ-----------------------KEVEKNLK
A0A2K6AI25_BCL2L2-      GNWASV------------RT----------VLTGAVALGALVT-------
A0A2K6AI25_BCL2L2-      GNAGPVIMSIEEKMEADARS----------IYVGNVDYGATAEELEAHFH
                                                                          

A0A2K5YR37_BCL2L1-      PPVPSMATH----PGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCV
A0A2K5XRD4_BCL2-01      RDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCV
A0A2K5YR37_BCL2L1-      RAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCV
A0A2K5XSB2_MCL1-03      GMLRKLDIKNEDDVKSL-SRV--MVHVFSDGVTNWGRIVTLISFGA----
A0A2K5YR37_BCL2L1-      RAFSDLTSQLHITPGTAYQSF-----------------------------
A0A2K5XSB2_MCL1-02      GWVCGV--------------------LPCRGPRRW---------------
A0A2K5XSB2_MCL1-01      GMLRKLDIKNEDDVKSL-SRV--MVHVFSDGVTNWGRIVTLISFGA----
A0A2K6AI25_BCL2L2-      GC------GSVNRVTILCDKF--SGHPKGFAYIEFSDKESVRTSLALDES
A0A2K6AD27_BCL2A1-      PCLDNVNVASIDTARTLFNQV--MEKEFEDGIINWGRIVTIFA-------
A0A2K6AD27_BCL2A1-      PCLDNVNVASIDTARTLFNQV--MEKEFEDGIINWGRIVTIFA-------
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      GC------GSVNRVTILCDKF--SGHPKGFAYIEFSDKESVRTSLALDES
                                                                          

A0A2K5YR37_BCL2L1-      ESVDKEMQVLVSRIAA------WMATYLNDHLEPWIQENGGWDTFVELYG
A0A2K5XRD4_BCL2-01      ESVNREMSPLVDNIAL------WMTEYLNRHLHTWIQDNGGWDAFVELYG
A0A2K5YR37_BCL2L1-      ESVDKEMQVLVSRIAA------WMATYLNDHLEPWIQENGGWDTFVELYG
A0A2K5XSB2_MCL1-03      -FVAKHLKTINQESCIEPLAESITDVLVRTKRD-----------------
A0A2K5YR37_BCL2L1-      ----------------------------------------EQDTFVELYG
A0A2K5XSB2_MCL1-02      -----------HQKCAAGFCRCCWS------RS-----------------
A0A2K5XSB2_MCL1-01      -FVAKHLKTINQESCIEPLAESITDVLVRTKRD-----------------
A0A2K6AI25_BCL2L2-      LFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFN
A0A2K6AD27_BCL2A1-      -FEGILIKKLLRQRIAPDVDT-----------------YKEISYFVAEFI
A0A2K6AD27_BCL2A1-      -FEGILIKKLLRQRIAPDVDT-----------------YKEISYFVAEFI
A0A2K6AI25_BCL2L2-      --------------------------------------------------
A0A2K6AI25_BCL2L2-      LFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFN
                                                                          

A0A2K5YR37_BCL2L1-      NNAAAESRKGQERFNR-----------WFLTGMTVAGVVLLGSLFSRK--
A0A2K5XRD4_BCL2-01      PSM-------RPLFDFSWLSLK-----TLLSLALVGACITLGAYLGHK--
A0A2K5YR37_BCL2L1-      NNAAAESRKGQERFN------R-----WFLTGMTVAGVVLLGSLFSRK--
A0A2K5XSB2_MCL1-03      ---------------------------WLVKQRGWDGFVEFFHVEDLEGG
A0A2K5YR37_BCL2L1-      NNAAAESRKGQERFNR-----------WFLTGMTVAGVVLLGSLFSRK--
A0A2K5XSB2_MCL1-02      ---------------------------WF---------------------
A0A2K5XSB2_MCL1-01      ---------------------------WLVKQRGWDGFVEFFHVEDLEGG
A0A2K6AI25_BCL2L2-      SRPRGRVYRGRARATS-----------WYSPY------------------
A0A2K6AD27_BCL2A1-      MNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC-
A0A2K6AD27_BCL2A1-      MNNTGEWIRQNGGWGK-----------WHNHMPM---LVESVAHRKKKMA
A0A2K6AI25_BCL2L2-      -------------VGA-----------FFASK------------------
A0A2K6AI25_BCL2L2-      SRPRGRVYRGRARATS-----------WYSPY------------------
                                                                          

A0A2K5YR37_BCL2L1-      -----------------------
A0A2K5XRD4_BCL2-01      -----------------------
A0A2K5YR37_BCL2L1-      -----------------------
A0A2K5XSB2_MCL1-03      IRNVLLAFAGVAGVGAGLAYLIR
A0A2K5YR37_BCL2L1-      -----------------------
A0A2K5XSB2_MCL1-02      ------------GISNKIALL--
A0A2K5XSB2_MCL1-01      IRNVLLAFAGVAGVGAGLAYLIR
A0A2K6AI25_BCL2L2-      -----------------------
A0A2K6AD27_BCL2A1-      -----------------------
A0A2K6AD27_BCL2A1-      L----------------------
A0A2K6AI25_BCL2L2-      -----------------------
A0A2K6AI25_BCL2L2-      -----------------------
                                               

© 1998-2023Legal notice