Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-at-a-agyt-rlagdylgyvlr---yv-gag--ag-g--gppg------------------------------------
m--d-s----yamvalkvsgpiqrkl--p---lg--e-gaa-g-gylngteseeserrelllepepepepeeeppriggg
 maacefpdir-aiqgrrqckggqrglcg yegep svap-t-tdrglalakdalapef                 rtas
  hppataaangvfvmfgna-ahlnhsqc gawp  grpltgalpqtrra g  f t d                 prfp
    mrrlrra el  ny--g ayl ags   td  d l ed akepm                               a
    glgekde       y c  g    r               hdak                                
     f                                                                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pagtviggspgasppqaltpdprlvegpppigaivaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihsse
elapqpsvta stqsaeeeeeagrrardlgdprl                                             g
dgpgilhsqs hpgqrftsvsdvaftsg nw                                                 
   agf pg   a hp aqr  e  q    t                                                 
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------p---agp-------------------------------------
vpeleaikarvremeeeaeklkelqnevekqmnmsp-pgn---vimsieekmeadarsiyvgnvdygataeeleahfhgc
dwdvt sp                       llffa trr   llspvppevhlpladaim      speddfdgyepep
g                                    aaa   a      v   t            qag   srryrrd
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------l-r-----------------------prgrygattrkans
gsvnrvtllldkfsghpkgfayiefsdkesvrtslaldes-f-grqikvipkrtnrpgisttdrgf-ma-srsrstnyle
lgkrpavipclelvaesgnspstdg lpstpppaeeeede y  qslei srylreqatgak tk  --qp--gps-tsr
faemssq h tp t rgrfatvv                                            ippeap---s---
                                                                   st -  vldplhq
                                                                         aa   aa
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .                                                                       
tlrrvgdgvq-rprerayrgrlrav-------------------f-dg---nwgriv----f------------------
srskfyssfnsknhgtvfqpma--tnvksigtavtlfsqvmekv-s--vgt------tlfs-ggilikklptvtawwkkr
v-q---f-lh -ev-knlk-c-dnldiap eddrkslnrmsvhlpersp pt   v aiia eafvcvhekli       
-m-qaa-e e t-fr----d-vck-h tn dsrqqrvtl adeelqg i ir   l sfvv a vmaee           
r  a        s-fst s y aq       n  e  a    a  c    r         t   t lar           
a           r       w  g                                    e   a               
                    l                                                           
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      *                                         
-------------------l----ae----------rsWispyggw---f--------------------------l---
gfqpllrqriasvvrtyep-vyfv--wivnylvrtt-d yvqq---dgg-veffhvedleearrlregnwggwrnv-laf
    r keqegpdndemqeisesltsfmtsv ntnlge lrknr  gn  tklygpsmrp          afimtwmtva
           nqtsnqkscaaqisrvlmr  e rkht fq--   ek  chk rspfpl          ssvhsl sqt
           lkekdisr igpfqlscwg    qhaa  -ss   ae   a  edka            l dfkh pmk
           d aich k  dn cdr ae    h     hd     a        g                  f il 
                c     l   c  d           a                                   eg 
                      g      a                                                  

       490       500 
....:....|....:....|.
                     
----------a-l--------
allcgvvagl-y-irrylghk
vgvallltvkkqywtll    
tkivesgvligltmsk     
gaasamsskgckklga     
f  g ianhf ifca      
     a  aa f a       
                     
© 1998-2022Legal notice