Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------glkrnavialnlycggr--------g-g-g-g----p------------------------------------
mmmapmf--a----ag-a-----aqrqygyvc-l-p-s-gatp-lhqggrllatekepsgrreygngleseelepeslll
 ahtgttma-trtl--d-ggykl-l gkewdaqsvavrrrhlv    aaggegg gaagaagdisglaaqlhvt ge   
  amdrsaydaaravmayvaacys         k yaetpgad     m aa d f trf  tf d          d   
    apprsrpeerllvfihv ak         d g c a  a                                     
     al p nd i  k df             a   a                                          
        e                                                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
epepepepeeepprprappgapgpgpgsgapqsqeeeeepglviggpgdgrlvaffvfgaalcaesvnkemeplvgqvqe
                              agqrftqvsaetfesdsawt                              
                                      ad i s q nh                               
                                           q                                    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------agp-------------------
wmvayletrladwihaspppeleaikarvremepeaeklkelqnevekqmnmspppgn---vimsieekmeadarsiyvg
               siedaa tpdar  arppeigaevpdvtasparllffaatrar   l      e   p adaim 
                 ggw              hp asr pv rtsp ptp   a a   a                  
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------i--y--r-atgtt
nvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikv-pk-tr-pgisak
     spe   dgyepeplgkrpavlpllelv esgnspstdg lpstpppaeeeede y  qsteiesrrlnel-qd--
                                                               mldc fggiylqep-yl
                                                                       g    -  p
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .               .                                                     
dtk-prgrygattrkanstlrrvgdgvq-rprerafrgrlral------------------f-dg---nwgriv----f-
-rgf-ma-srsrstnylesrsqfyssfnsknhgtvyqpmadqvnvtpidtvrtlsrvvvev-s--vit------tlfs-g
q--lq--qpspvpsvtsrvmqkaaf-ls trvrknlkec--nthiksgtdaksffnqmmhlefedpgpt   v aiia e
eyv  ippea glpsvhqr  a---e h  effst sdyvsk-dlanesarqrvatmseakprrsg ir   l sfvv a
 pr  st l  aadplala      d e  sy  d a wsc-     fnrqgl tq ad  lqg   v         t  
                 a                    l ag         e   l      c    r         e  
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       *                        
-----------------------------------pl---i------------rsWispyggw-------------f---
gilikklltitawwkkrgfqprlkeqegsvnscme--vks-sywlveylmntt-d yvqq---dggfvkkfepksg-vef
afvcvhekrv                  qrirpivdtyeevtsvvarfintnlge lrknr  gn           wttl
 vmaee pl                   nqekedsrfarqlwdfmtg  errkht fq--   ek            mnh
 t lar                      dhqadcqg cgncqlr  a    qhaa  -ss   ae            hh 
 a                            a  aa   dl ae        h     hd     a            ca 
                                      ac                  a                     

       490       500       510       520     
....:....|....:....|....:....|....:....|....:
                                             
---------------------------------------------
fhvedlevesvswlkqkgglrnvllgaagvagvgtglaylirrll
ygstmrllfrrlrksnyasistl vafvltlllyaviklfwtk  
mrpsgppeamlaleglwtlw la tq filgaivnkhgf as   
lpmpfkic df h  k mfv k  i  caac aslag        
 edga            ca              a  f        
                                             
© 1998-2022Legal notice