Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAP------
A0A2K6EA59_BCL2L2-      ---MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMR
A0A2K6EA59_BCL2L2-      -------MAAAAAAAAAAGAAGGR--------GSGPGRRRHLVP---GAG
A0A2K6EA59_BCL2L2-      -------MAAAAAAAAAAGAAGGR--------GSGPGRRRHLVP---GAG
A0A2K6ECR0_MCL1-02      -----MFGLKRNAVIGLNLYCGGA--------GLGAGSGGATPP---GGR
A0A2K6ECR0_MCL1-01      -----MFGLKRNAVIGLNLYCGGA--------GLGAGSGGATPP---GGR
A0A2K6EA59_BCL2L2-      -MATPASAPDTRALVADFVGYKLR--------QKGYVCGA----------
A0A2K6B2D9_BCL2L10      --MADPLRERTERLLADYLGCCAR--------------------------
A0A2K6ECR0_MCL1-03      -----MFGLKRNAVIGLNLYCGGA--------GLGAGSGGATPP------
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K6EA59_BCL2L2-      AAGDEFETRFRRTFSDLAAQLHVTPGS-----------------------
A0A2K6EA59_BCL2L2-      GEAGEGAPGGAGDYGNGLESEELEPED-----------------------
A0A2K6EA59_BCL2L2-      GEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPG
A0A2K6ECR0_MCL1-02      LLATEKEASARREIGGG---------------------------------
A0A2K6ECR0_MCL1-01      LLATEKEASARREIGGG---------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      ------------------APGIFSSQPGHT--------------------
A0A2K6EA59_BCL2L2-      ----------AQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKE
A0A2K6EA59_BCL2L2-      -------------QEEEEEPGLVEGDPGDG--------------------
A0A2K6EA59_BCL2L2-      APGPGPGSGAPGSQEEEEEPGLVEGDPGDG--------------------
A0A2K6ECR0_MCL1-02      ------------------EAGTVIGGSA-G--------------------
A0A2K6ECR0_MCL1-01      ------------------EAGTVIGGSA-G--------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      -------------------------------------------PHPAASR
A0A2K6EA59_BCL2L2-      MEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLK
A0A2K6EA59_BCL2L2-      -------------------------AIEDPELEAIKARVREMEEEAEKLK
A0A2K6EA59_BCL2L2-      -------------------------AIEDPELEAIKARVREMEEEAEKLK
A0A2K6ECR0_MCL1-02      -------------------------ASPPAALTPDARRVARPPPIGAEVP
A0A2K6ECR0_MCL1-01      -------------------------ASPPAALTPDARRVARPPPIGAEVP
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      DPVARTSPLPTPAAPAAAAGPA----------------------------
A0A2K6EA59_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6EA59_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6EA59_BCL2L2-      ELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEE
A0A2K6ECR0_MCL1-02      DVTASPARLLFFAPTR-RAGPL-----EEMEAPAADAIM------SPEEE
A0A2K6ECR0_MCL1-01      DVTASPARLLFFAPTR-RAGPL-----EEMEAPAADAIM------SPEEE
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K6EA59_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K6EA59_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K6EA59_BCL2L2-      LEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
A0A2K6ECR0_MCL1-02      LDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELY
A0A2K6ECR0_MCL1-01      LDGYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELY
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQ-K
A0A2K6DS18_BCL2A1-      ---MTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQ-K
A0A2K6CIX3_BCL2-01      ----------------------------LSPVPPVVHLTLRQAGDDFS-R
A0A2K6EA59_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K6EA59_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K6EA59_BCL2L2-      RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K6ECR0_MCL1-02      R-QSLEIISRYLREQATGAKDTK-PMGRSGATSRKALETLRRVGDGVQ-R
A0A2K6ECR0_MCL1-01      R-QSLEIISRYLREQATGAKDTK-PMGRSGATSRKALETLRRVGDGVQ-R
A0A2K6EA59_BCL2L2-      ---------------GPG----------EGPAADPLHQAMRAAGDEFE-T
A0A2K6B2D9_BCL2L10      ---------------EPGTPEPR-PSTPEAAVLRSAAARLRQ----LH-R
A0A2K6ECR0_MCL1-03      ----------GGRLLATGAKDTK-PMGRSGATSRKALETLRRVGDGVQ-R
                                                      .               .   

A0A2K6DS18_BCL2A1-      EVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFE
A0A2K6DS18_BCL2A1-      EVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFE
A0A2K6CIX3_BCL2-01      RYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG--VNWGRIVAFFEFG
A0A2K6EA59_BCL2L2-      PRGRVYRGRARAT-------------------------------------
A0A2K6EA59_BCL2L2-      PRGRVYRGRARAT-------------------------------------
A0A2K6EA59_BCL2L2-      PRGRVYRGRARAT-------------------------------------
A0A2K6ECR0_MCL1-02      NHETAFQGWVCGV-----------------LPCRGP-RRW----------
A0A2K6ECR0_MCL1-01      NHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFG
A0A2K6EA59_BCL2L2-      RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG--PNWGRLVAFFVFG
A0A2K6B2D9_BCL2L10      SFFSAYRGY-------PGNRVELVALMAEAVLSDSPGPTWGRVVSLVTFA
A0A2K6ECR0_MCL1-03      NHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFG
                                                                          

A0A2K6DS18_BCL2A1-      GILIKKLLR-------------------QRIAPDVDTYKEISYFVAEFIM
A0A2K6DS18_BCL2A1-      GILIKKLLR-------------------QRIAPDVDTYKEISYFVAEFIM
A0A2K6CIX3_BCL2-01      GVMCVE----------------------SVNREMSPLVDNIALWMTEYLN
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6ECR0_MCL1-02      -----------------------------HQKCAAGFCRCCWS-------
A0A2K6ECR0_MCL1-01      AFVAKHLKTI------------------NQESCIEPLAESITDVLVR---
A0A2K6EA59_BCL2L2-      AALCAE----------------------SVNKEMEPLVGQVQEWMVAYLE
A0A2K6B2D9_BCL2L10      GTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAG---
A0A2K6ECR0_MCL1-03      AFVAKHLKTI------------------NQESCIEPLAESITDVLVR---
                                                                          

A0A2K6DS18_BCL2A1-      NNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC--
A0A2K6DS18_BCL2A1-      NNTGEWIRQNGGWGK-----------WHNHMPM---LVESVAHKKKKMAL
A0A2K6CIX3_BCL2-01      RHLHTWIQDNGGWDA-----------FVELYGPSMRPLFDFSWLSLKTLL
A0A2K6EA59_BCL2L2-      ----SWYSPY----------------------------------------
A0A2K6EA59_BCL2L2-      ----SWYSPY----------------------------------------
A0A2K6EA59_BCL2L2-      ----SWYSPY----------------------------------------
A0A2K6ECR0_MCL1-02      ---RSWF-------------------------------------------
A0A2K6ECR0_MCL1-01      -TKRDWLVKQRGWDG-----------FVEFFHVEDLE----------GGI
A0A2K6EA59_BCL2L2-      TRLADWIHSSGGWAE-----------FTALYGDGALEEARRLREGNWASV
A0A2K6B2D9_BCL2L10      -QHRAWLQAQGGWDG-----------FCHFFRSPFPL----------AFW
A0A2K6ECR0_MCL1-03      -TKRDWLVKQRGWDG-----------FVEFFHVEDLE----------GGI
                             *                                            

A0A2K6DS18_BCL2A1-      -------------------------
A0A2K6DS18_BCL2A1-      -------------------------
A0A2K6CIX3_BCL2-01      SLALVGACITLGAYLGHK-------
A0A2K6EA59_BCL2L2-      -------------------------
A0A2K6EA59_BCL2L2-      -------------------------
A0A2K6EA59_BCL2L2-      -------------------------
A0A2K6ECR0_MCL1-02      -----------GISNKIALL-----
A0A2K6ECR0_MCL1-01      RNVLLAFAGVAGVGAGLAYLIR---
A0A2K6EA59_BCL2L2-      RTVLTGAVALGALVTVGAFFASK--
A0A2K6B2D9_BCL2L10      RKLLIQAFLACLLATAFGYLWTRLL
A0A2K6ECR0_MCL1-03      RNVLLAFAGVAGVGAGLAYLIR---
                                                 

© 1998-2020Legal notice