Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6CIX3_BCL2-01      MAHAGRTGYDNREIVMKY---IHYKLSQRGYEWDAGDVGAATPG------
A0A2K6ECQ5_MCL1-01      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT
A0A2K6ECQ5_MCL1-02      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT
A0A2K6EA59_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A2K6EA59_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A2K6EA59_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A2K6DS18_BCL2A1-      -MTDCEFGYIYRLAQDYLQYVLQ---------------------------
A0A2K6DS18_BCL2A1-      -MTDCEFGYIYRLAQDYLQYVLQ---------------------------
A0A2K6EA59_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGA---------GPG-------
A0A2K6B2D9_BCL2L10      -MADPLRERTERLLADYLGCCAR-----------------EPGTPEPR--
A0A2K6ECQ5_MCL1-03      ----MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGAKDTK--
                                                                          

A0A2K6CIX3_BCL2-01      ----------------------------AAPAPGIFSSQPGHTPHPAASR
A0A2K6ECQ5_MCL1-01      EKEASARRE-----------------IGGGEAGTVIGGSAGASPPAALTP
A0A2K6ECQ5_MCL1-02      EKEASARRE-----------------IGGGEAGTVIGGSAGASPPAALTP
A0A2K6EA59_BCL2L2-      AGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQV
A0A2K6EA59_BCL2L2-      ESEELEPED------------------------------------QEEEE
A0A2K6EA59_BCL2L2-      ESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      DPVARTSPLPTPA-------------------------------------
A0A2K6ECQ5_MCL1-01      DARRVARPPPIGA-------------------------------------
A0A2K6ECQ5_MCL1-02      DARRVARPPPIGA-------------------------------------
A0A2K6EA59_BCL2L2-      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A2K6EA59_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
A0A2K6EA59_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      ---------------------------------------------APAAA
A0A2K6ECQ5_MCL1-01      ---------EVPDVTASPAR---------------------LLFFAPTRR
A0A2K6ECQ5_MCL1-02      ---------EVPDVTASPAR---------------------LLFFAPTRR
A0A2K6EA59_BCL2L2-      RLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2K6EA59_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2K6EA59_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      AGPALSPVPPVVHLTLR----------QAGDDFSRRYRRDFAEMSSQLHL
A0A2K6ECQ5_MCL1-01      AGPL-----EEMEAPAADAIM------SPEEELDGYEPEPLGKRPAVLPL
A0A2K6ECQ5_MCL1-02      AGPL-----EEMEAPAADAIM------SPEEELDGYEPEPLGKRPAVLPL
A0A2K6EA59_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2K6EA59_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2K6EA59_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      TPFTARGRFATVV---------------EELFR-----------------
A0A2K6ECQ5_MCL1-01      LELVGESGNSPSTDGSLPSTPPPAEEEEDELYR-QSLEIISRYLREQATG
A0A2K6ECQ5_MCL1-02      LELVGESGNSPSTDGSLPSTPPPAEEEEDELYR-QSLEIISRYLREQATG
A0A2K6EA59_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
A0A2K6EA59_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
A0A2K6EA59_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      --------------------------DGVN--------------------
A0A2K6ECQ5_MCL1-01      AKDTK-PMGRSGATSRKALETLRRVGDGVQ-RNHETAFQGMLRKLDIKN-
A0A2K6ECQ5_MCL1-02      AKDTK-PMGRSGATSRKALETLRRVGDGVQ-RNHETAFQGWVCGV-----
A0A2K6EA59_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT-----
A0A2K6EA59_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT-----
A0A2K6EA59_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT-----
A0A2K6DS18_BCL2A1-      -------IPQPGSGPSKTSRVLQKVAFSVQ-KEVEKNLKPCLDNVNVASI
A0A2K6DS18_BCL2A1-      -------IPQPGSGPSKTSRVLQKVAFSVQ-KEVEKNLKPCLDNVNVASI
A0A2K6EA59_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFE-TRFRRTFSDLAAQLHVTP-
A0A2K6B2D9_BCL2L10      ------PSTPEAAVLRSAAARLRQ----LH-RSFFSAYRGY-------P-
A0A2K6ECQ5_MCL1-03      ------PMGRSGATSRKALETLRRVGDGVQ-RNHETAFQGMLRKLDIKN-
                                                    .                     

A0A2K6CIX3_BCL2-01      ----------------------WGRIVAFFEFGGVMCVE-----------
A0A2K6ECQ5_MCL1-01      EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKH-----------
A0A2K6ECQ5_MCL1-02      -------------LPCRGP-RRW---------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      DTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKK-----------
A0A2K6DS18_BCL2A1-      DTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKK-----------
A0A2K6EA59_BCL2L2-      GSAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAALCAE-----------
A0A2K6B2D9_BCL2L10      GNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKR
A0A2K6ECQ5_MCL1-03      EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI-------
                                                                          

A0A2K6CIX3_BCL2-01      -----------SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDA-F
A0A2K6ECQ5_MCL1-01      -----------LKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDG-F
A0A2K6ECQ5_MCL1-02      ----------------HQKCAAGFCRCCWS------RSWF----------
A0A2K6EA59_BCL2L2-      -------------------------------------SWYSPY-------
A0A2K6EA59_BCL2L2-      -------------------------------------SWYSPY-------
A0A2K6EA59_BCL2L2-      -------------------------------------SWYSPY-------
A0A2K6DS18_BCL2A1-      ----LLRQRIAPDVDTYKEISYFVAEFIMN----NTGEWIRQNGGWGK--
A0A2K6DS18_BCL2A1-      ----LLRQRIAPDVDTYKEISYFVAEFIMN----NTGEWIRQNGGWENGF
A0A2K6EA59_BCL2L2-      -----------SVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAE-F
A0A2K6B2D9_BCL2L10      GFQPRLKEQEGDVARDCQRLVALLSSRLAG----QHRAWLQAQGGWDG-F
A0A2K6ECQ5_MCL1-03      -----------NQESCIEPLAESITDVLVR----TKRDWLVKQRGWDG-F
                                                              *           

A0A2K6CIX3_BCL2-01      VELYGPSMRP----------LFDFSWLSLKTLLSLALVGACITLGAYLGH
A0A2K6ECQ5_MCL1-01      VEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLAYLIR-----
A0A2K6ECQ5_MCL1-02      ----------------------------------GISNKIALL-------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      ----------------------WHNHMPM---LVESVAHKKKKMAL----
A0A2K6DS18_BCL2A1-      VKKFEPK-------------SGWMTFLEVTGKICEMLSLLKQYC------
A0A2K6EA59_BCL2L2-      TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK----
A0A2K6B2D9_BCL2L10      CHFFRSPFPL----------AFWRKLLIQAFLACLLATAFGYLWTRLL--
A0A2K6ECQ5_MCL1-03      VEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLAYLIR-----
                                                                          

A0A2K6CIX3_BCL2-01      K
A0A2K6ECQ5_MCL1-01      -
A0A2K6ECQ5_MCL1-02      -
A0A2K6EA59_BCL2L2-      -
A0A2K6EA59_BCL2L2-      -
A0A2K6EA59_BCL2L2-      -
A0A2K6DS18_BCL2A1-      -
A0A2K6DS18_BCL2A1-      -
A0A2K6EA59_BCL2L2-      -
A0A2K6B2D9_BCL2L10      -
A0A2K6ECQ5_MCL1-03      -
                         

© 1998-2021Legal notice