Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------MATPASAPDTRALVADFVGYKLRQKGYVCGA---------GP
A0A2K6B2D9_BCL2L10      ---------MADPLRERTERLLADYLGCCAR-----------------EP
A0A2K6ECQ5_MCL1-03      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT
A0A2K6CIX3_BCL2-01      MAHAGRTGYDNREIVMKY---IHYKLSQRGYEWDAGDVGAATPG------
A0A2K6ECQ5_MCL1-02      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT
A0A2K6ECQ5_MCL1-01      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT
A0A2K6EA59_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A2K6EA59_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A2K6EA59_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      G-------------------------------------------------
A0A2K6B2D9_BCL2L10      GTPEPR--------------------------------------------
A0A2K6ECQ5_MCL1-03      GAKDTK--------------------------------------------
A0A2K6CIX3_BCL2-01      ----------------------------AAPAPGIFSSQPGHTPHPAASR
A0A2K6ECQ5_MCL1-02      EKEASARRE-----------------IGGGEAGTVIGGSAGASPPAALTP
A0A2K6ECQ5_MCL1-01      EKEASARRE-----------------IGGGEAGTVIGGSAGASPPAALTP
A0A2K6EA59_BCL2L2-      AGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQV
A0A2K6EA59_BCL2L2-      ESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
A0A2K6EA59_BCL2L2-      ESEELEPED------------------------------------QEEEE
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
A0A2K6CIX3_BCL2-01      DPVARTSPLPTPA-------------------------------------
A0A2K6ECQ5_MCL1-02      DARRVARPPPIGA-------------------------------------
A0A2K6ECQ5_MCL1-01      DARRVARPPPIGA-------------------------------------
A0A2K6EA59_BCL2L2-      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A2K6EA59_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
A0A2K6EA59_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
A0A2K6CIX3_BCL2-01      ---------------------------------------------APAAA
A0A2K6ECQ5_MCL1-02      ---------EVPDVTASPAR---------------------LLFFAPTRR
A0A2K6ECQ5_MCL1-01      ---------EVPDVTASPAR---------------------LLFFAPTRR
A0A2K6EA59_BCL2L2-      RLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2K6EA59_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
A0A2K6EA59_BCL2L2-      ---------EDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGN
                                                                          

A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
A0A2K6CIX3_BCL2-01      AGPALSPVPPVVHLTLR----------QAGDDFSRRYRRDFAEMSSQLHL
A0A2K6ECQ5_MCL1-02      AGPL-----EEMEAPAADAIM------SPEEELDGYEPEPLGKRPAVLPL
A0A2K6ECQ5_MCL1-01      AGPL-----EEMEAPAADAIM------SPEEELDGYEPEPLGKRPAVLPL
A0A2K6EA59_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2K6EA59_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2K6EA59_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
                                                                          

A0A2K6DS18_BCL2A1-      -----------------------------------MTDCEFGYIYRLAQD
A0A2K6DS18_BCL2A1-      -----------------------------------MTDCEFGYIYRLAQD
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
A0A2K6CIX3_BCL2-01      TPFTARGRFATVV---------------EELFR-----------------
A0A2K6ECQ5_MCL1-02      LELVGESGNSPSTDGSLPSTPPPAEEEEDELYR-QSLEIISRYLREQATG
A0A2K6ECQ5_MCL1-01      LELVGESGNSPSTDGSLPSTPPPAEEEEDELYR-QSLEIISRYLREQATG
A0A2K6EA59_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
A0A2K6EA59_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
A0A2K6EA59_BCL2L2-      DKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGIS
                                                                          

A0A2K6DS18_BCL2A1-      YLQYVLQIPQPGSGPSKTSRVLQKVAFSVQ-KEVEKNLKPCLDNVNVASI
A0A2K6DS18_BCL2A1-      YLQYVLQIPQPGSGPSKTSRVLQKVAFSVQ-KEVEKNLKPCLDNVNVASI
A0A2K6EA59_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFE-TRFRRTFSDLAAQLHVTPG
A0A2K6B2D9_BCL2L10      ------PSTPEAAVLRSAAARLRQ----LH-RSFFSAYRGY-------PG
A0A2K6ECQ5_MCL1-03      ------PMGRSGATSRKALETLRRVGDGVQ-RNHETAFQGMLRKLDIKNE
A0A2K6CIX3_BCL2-01      --------------------------DGVN--------------------
A0A2K6ECQ5_MCL1-02      AKDTK-PMGRSGATSRKALETLRRVGDGVQ-RNHETAFQGWVCGV-----
A0A2K6ECQ5_MCL1-01      AKDTK-PMGRSGATSRKALETLRRVGDGVQ-RNHETAFQGMLRKLDIKNE
A0A2K6EA59_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT-----
A0A2K6EA59_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT-----
A0A2K6EA59_BCL2L2-      TTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT-----
                                                    .                     

A0A2K6DS18_BCL2A1-      DTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLR---------
A0A2K6DS18_BCL2A1-      DTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLR---------
A0A2K6EA59_BCL2L2-      SAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAALCAE------------
A0A2K6B2D9_BCL2L10      NRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRG
A0A2K6ECQ5_MCL1-03      DDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI--------
A0A2K6CIX3_BCL2-01      ---------------------WGRIVAFFEFGGVMCVE------------
A0A2K6ECQ5_MCL1-02      ------------LPCRGP-RRW----------------------------
A0A2K6ECQ5_MCL1-01      DDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKH------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      ----------QRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFV
A0A2K6DS18_BCL2A1-      ----------QRIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWGK---
A0A2K6EA59_BCL2L2-      ----------SVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAE---
A0A2K6B2D9_BCL2L10      FQPRLKEQEGDVARDCQRLVALLSSRLAG----QHRAWLQAQGGWDG---
A0A2K6ECQ5_MCL1-03      ----------NQESCIEPLAESITDVLVR----TKRDWLVKQRGWDG---
A0A2K6CIX3_BCL2-01      ----------SVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDA---
A0A2K6ECQ5_MCL1-02      ---------------HQKCAAGFCRCCWS------RSWF-----------
A0A2K6ECQ5_MCL1-01      ----------LKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDG---
A0A2K6EA59_BCL2L2-      ------------------------------------SWYSPY--------
A0A2K6EA59_BCL2L2-      ------------------------------------SWYSPY--------
A0A2K6EA59_BCL2L2-      ------------------------------------SWYSPY--------
                                                             *            

A0A2K6DS18_BCL2A1-      KKFEPKSGWMTFLEVTGKICEMLSLLKQYC--------------------
A0A2K6DS18_BCL2A1-      --------WHNHMPM---LVESVAHKKKKMAL------------------
A0A2K6EA59_BCL2L2-      --------FTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGA
A0A2K6B2D9_BCL2L10      --------FCHFFRSPFPL----------AFWRKLLIQAFLACLLATAFG
A0A2K6ECQ5_MCL1-03      --------FVEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLA
A0A2K6CIX3_BCL2-01      --------FVELYGPSMRP----------LFDFSWLSLKTLLSLALVGAC
A0A2K6ECQ5_MCL1-02      -------------------------------------------GISNKIA
A0A2K6ECQ5_MCL1-01      --------FVEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLA
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K6DS18_BCL2A1-      ----------
A0A2K6DS18_BCL2A1-      ----------
A0A2K6EA59_BCL2L2-      FFASK-----
A0A2K6B2D9_BCL2L10      YLWTRLL---
A0A2K6ECQ5_MCL1-03      YLIR------
A0A2K6CIX3_BCL2-01      ITLGAYLGHK
A0A2K6ECQ5_MCL1-02      LL--------
A0A2K6ECQ5_MCL1-01      YLIR------
A0A2K6EA59_BCL2L2-      ----------
A0A2K6EA59_BCL2L2-      ----------
A0A2K6EA59_BCL2L2-      ----------
                                  

© 1998-2023Legal notice