Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6CIX3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGY--EWDAGDVGAATP---GAAP-
A0A2K6EA59_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAA
A0A2K6EA59_BCL2L2-      -----MAAAAAAAAAAGAAGGR--------GSGPGRRRHLVP---GAGGE
A0A2K6EA59_BCL2L2-      -----MAAAAAAAAAAGAAGGR--------GSGPGRRRHLVP---GAGGE
A0A2K6ECQ5_MCL1-02      ---MFGLKRNAVIGLNLYCGGA--------GLGAGSGGATPP---GGRLL
A0A2K6ECQ5_MCL1-01      ---MFGLKRNAVIGLNLYCGGA--------GLGAGSGGATPP---GGRLL
A0A2K6DS18_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ--------------------------
A0A2K6DS18_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ--------------------------
A0A2K6EA59_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGA---------G--------
A0A2K6B2D9_BCL2L10      --MADPLRERTERLLADYLGCCAR-----------------E--------
A0A2K6ECQ5_MCL1-03      -----MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA--------
                                                                          

A0A2K6CIX3_BCL2-01      --------------------------------------------------
A0A2K6EA59_BCL2L2-      GDEFETRFRRTFSDLAAQLHVTPGS-------------------------
A0A2K6EA59_BCL2L2-      AGEGAPGGAGDYGNGLESEELEPED-------------------------
A0A2K6EA59_BCL2L2-      AGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAP
A0A2K6ECQ5_MCL1-02      ATEKEASARREIGGG-----------------------------------
A0A2K6ECQ5_MCL1-01      ATEKEASARREIGGG-----------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      ----------------APGIFSSQPGHT----------------------
A0A2K6EA59_BCL2L2-      --------AQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEME
A0A2K6EA59_BCL2L2-      -----------QEEEEEPGLVEGDPGDG----------------------
A0A2K6EA59_BCL2L2-      GPGPGSGAPGSQEEEEEPGLVEGDPGDG----------------------
A0A2K6ECQ5_MCL1-02      ----------------EAGTVIGGSA-G----------------------
A0A2K6ECQ5_MCL1-01      ----------------EAGTVIGGSA-G----------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      -----------------------PHPAASRDPVARTSPLPTP--------
A0A2K6EA59_BCL2L2-      PLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKEL
A0A2K6EA59_BCL2L2-      -----------------------AIEDPELEAIKARVREMEEEAEKLKEL
A0A2K6EA59_BCL2L2-      -----------------------AIEDPELEAIKARVREMEEEAEKLKEL
A0A2K6ECQ5_MCL1-02      -----------------------ASPPAALTPDARRVARPPPIGAEVPDV
A0A2K6ECQ5_MCL1-01      -----------------------ASPPAALTPDARRVARPPPIGAEVPDV
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      ----------AAPAAAAGPALSPVPPVVHLTLR----------QAGDDFS
A0A2K6EA59_BCL2L2-      QNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELE
A0A2K6EA59_BCL2L2-      QNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELE
A0A2K6EA59_BCL2L2-      QNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELE
A0A2K6ECQ5_MCL1-02      TASPARLLFFAPTR-RAGPL-----EEMEAPAADAIM------SPEEELD
A0A2K6ECQ5_MCL1-01      TASPARLLFFAPTR-RAGPL-----EEMEAPAADAIM------SPEEELD
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      RRYRRDFAEMSSQLHLTPFTARGRFATVV---------------EELFR-
A0A2K6EA59_BCL2L2-      AHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRG
A0A2K6EA59_BCL2L2-      AHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRG
A0A2K6EA59_BCL2L2-      AHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRG
A0A2K6ECQ5_MCL1-02      GYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYR-
A0A2K6ECQ5_MCL1-01      GYEPEPLGKRPAVLPLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYR-
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECQ5_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      ------------------------------------------DGVN----
A0A2K6EA59_BCL2L2-      RQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR
A0A2K6EA59_BCL2L2-      RQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR
A0A2K6EA59_BCL2L2-      RQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR
A0A2K6ECQ5_MCL1-02      QSLEIISRYLREQATGAKDTK-PMGRSGATSRKALETLRRVGDGVQ-RNH
A0A2K6ECQ5_MCL1-01      QSLEIISRYLREQATGAKDTK-PMGRSGATSRKALETLRRVGDGVQ-RNH
A0A2K6DS18_BCL2A1-      -----------------------IPQPGSGPSKTSRVLQKVAFSVQ-KEV
A0A2K6DS18_BCL2A1-      -----------------------IPQPGSGPSKTSRVLQKVAFSVQ-KEV
A0A2K6EA59_BCL2L2-      ---------------PG---------EGPAADPLHQAMRAAGDEFE-TRF
A0A2K6B2D9_BCL2L10      ---------------PGTPEPRPSTPEAAVLRSAAARLRQ----LH-RSF
A0A2K6ECQ5_MCL1-03      ---------------TGAKDTKPMGRSGATSRKALETLRRVGDGVQ-RNH
                                                                    .     

A0A2K6CIX3_BCL2-01      --------------------------------------WGRIVAFFEFGG
A0A2K6EA59_BCL2L2-      GRVYRGRARAT---------------------------------------
A0A2K6EA59_BCL2L2-      GRVYRGRARAT---------------------------------------
A0A2K6EA59_BCL2L2-      GRVYRGRARAT---------------------------------------
A0A2K6ECQ5_MCL1-02      ETAFQGWVCGV------------------LPCRGP-RRW-----------
A0A2K6ECQ5_MCL1-01      ETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGA
A0A2K6DS18_BCL2A1-      EKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEG
A0A2K6DS18_BCL2A1-      EKNLKPCLDNVNVASIDTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEG
A0A2K6EA59_BCL2L2-      RRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQGG--PNWGRLVAFFVFGA
A0A2K6B2D9_BCL2L10      FSAYRGY-------P-GNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAG
A0A2K6ECQ5_MCL1-03      ETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGA
                                                                          

A0A2K6CIX3_BCL2-01      VMCVE----------------------SVNREMSPLVDNIALWMTEYLNR
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6ECQ5_MCL1-02      --------------------------------HQKCAAGFCRCCWS----
A0A2K6ECQ5_MCL1-01      FVAKH----------------------LKTINQESCIEPLAESITDVLVR
A0A2K6DS18_BCL2A1-      ILIKK---------------LLRQRIAPDVDTYKEISYFVAEFIMN----
A0A2K6DS18_BCL2A1-      ILIKK---------------LLRQRIAPDVDTYKEISYFVAEFIMN----
A0A2K6EA59_BCL2L2-      ALCAE----------------------SVNKEMEPLVGQVQEWMVAYLET
A0A2K6B2D9_BCL2L10      TLLEREPLVTAWWKKRGFQPRLKEQEGDVARDCQRLVALLSSRLAG----
A0A2K6ECQ5_MCL1-03      FVAKHLKTI------------------NQESCIEPLAESITDVLVR----
                                                                          

A0A2K6CIX3_BCL2-01      HLHTWIQDNGGWDA-FVELYGPSMRP----------LFDFSWLSLKTLLS
A0A2K6EA59_BCL2L2-      ---SWYSPY-----------------------------------------
A0A2K6EA59_BCL2L2-      ---SWYSPY-----------------------------------------
A0A2K6EA59_BCL2L2-      ---SWYSPY-----------------------------------------
A0A2K6ECQ5_MCL1-02      --RSWF--------------------------------------------
A0A2K6ECQ5_MCL1-01      TKRDWLVKQRGWDG-FVEFFHVEDLE----------GGIRNVLLAFAGVA
A0A2K6DS18_BCL2A1-      NTGEWIRQNGGWENGFVKKFEPK-------------SGWMTFLEVTGKIC
A0A2K6DS18_BCL2A1-      NTGEWIRQNGGWGK------------------------WHNHMPM---LV
A0A2K6EA59_BCL2L2-      RLADWIHSSGGWAE-FTALYGDGALEEARRLREGNWASVRTVLTGAVALG
A0A2K6B2D9_BCL2L10      QHRAWLQAQGGWDG-FCHFFRSPFPL----------AFWRKLLIQAFLAC
A0A2K6ECQ5_MCL1-03      TKRDWLVKQRGWDG-FVEFFHVEDLE----------GGIRNVLLAFAGVA
                            *                                             

A0A2K6CIX3_BCL2-01      LALVGACITLGAYLGHK
A0A2K6EA59_BCL2L2-      -----------------
A0A2K6EA59_BCL2L2-      -----------------
A0A2K6EA59_BCL2L2-      -----------------
A0A2K6ECQ5_MCL1-02      GISNKIALL--------
A0A2K6ECQ5_MCL1-01      GVGAGLAYLIR------
A0A2K6DS18_BCL2A1-      EMLSLLKQYC-------
A0A2K6DS18_BCL2A1-      ESVAHKKKKMAL-----
A0A2K6EA59_BCL2L2-      ALVTVGAFFASK-----
A0A2K6B2D9_BCL2L10      LLATAFGYLWTRLL---
A0A2K6ECQ5_MCL1-03      GVGAGLAYLIR------
                                         

© 1998-2021Legal notice