Dataset for protein BCL-2-like of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6CIX3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATP----------
A0A2K6ECR0_MCL1-02      -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATPPGGRLLATEKE
A0A2K6DS18_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ--------------------------
A0A2K6DS18_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQ--------------------------
A0A2K6EA59_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGA------------------
A0A2K6EA59_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGA------------------
A0A2K6B2D9_BCL2L10      --MADPLRERTERLLADYLGCCAR--------------------------
A0A2K6ECR0_MCL1-03      -----MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPG-------------
                                     :    :                               

A0A2K6CIX3_BCL2-01      -------GAAPAPGIFSSQPGHTPHPAASRD-------------------
A0A2K6ECR0_MCL1-02      ASARREIGGGEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTA
A0A2K6DS18_BCL2A1-      -----------IPQ---------PGSGPSKT-------------------
A0A2K6DS18_BCL2A1-      -----------IPQ---------PGSGPSKT-------------------
A0A2K6EA59_BCL2L2-      -----------GPG---------EGPAADPL-------------------
A0A2K6EA59_BCL2L2-      -----------GPG---------EGPAADPL-------------------
A0A2K6B2D9_BCL2L10      -----------EPGTPEPRPSTPEAAVLRSA-------------------
A0A2K6ECR0_MCL1-03      -------GRLLATGAKDTKPMGRSGATSRKA-------------------
                                                 .                        

A0A2K6CIX3_BCL2-01      ---------PVARTSPLPTPAAPAAAA------------------GPALS
A0A2K6ECR0_MCL1-02      SPARLLFFAPTRRAGPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6EA59_BCL2L2-      --------------------------------------------------
A0A2K6B2D9_BCL2L10      --------------------------------------------------
A0A2K6ECR0_MCL1-03      --------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      PVPPVV-------------HLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-
A0A2K6ECR0_MCL1-02      PLLELVGESGNSPSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQA-
A0A2K6DS18_BCL2A1-      -------------------SRVLQKVAFSVQKEVEKNLKPCLDNVNVASI
A0A2K6DS18_BCL2A1-      -------------------SRVLQKVAFSVQKEVEKNLKPCLDNVNVASI
A0A2K6EA59_BCL2L2-      -------------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-
A0A2K6EA59_BCL2L2-      -------------------HQAMRAAGDEFETRFRRTFSDLAAQLHVTP-
A0A2K6B2D9_BCL2L10      -------------------AARLRQ----LHRSFFSAYRGY-------P-
A0A2K6ECR0_MCL1-03      -------------------LETLRRVGDGVQRNHETAFQGMLRKLDIKN-
                                                                          

A0A2K6CIX3_BCL2-01      FTARGRFATVVEELFRDG--VNWGRIVAFFEFGGVMCVE-----------
A0A2K6ECR0_MCL1-02      TGAKD-----TKPMGRSG--ATSRKALETLRRVG----D-----------
A0A2K6DS18_BCL2A1-      DTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKK-----------
A0A2K6DS18_BCL2A1-      DTARTLFNQVMEKEFEDGI-INWGRIVTIFAFEGILIKK-----------
A0A2K6EA59_BCL2L2-      GSAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAALCAE-----------
A0A2K6EA59_BCL2L2-      GSAQQRFTQVSDELFQGG--PNWGRLVAFFVFGAALCAE-----------
A0A2K6B2D9_BCL2L10      GNRVELVALMAEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKR
A0A2K6ECR0_MCL1-03      EDDVKSLSRVMVHVFSDGV-TNWGRIVTLISFGAFVAKHLKTI-------
                                        ..   .  . :  .   .                

A0A2K6CIX3_BCL2-01      -----------SVNREMSPLVDNIAL---WMTEYLN-RHLHTWIQDNGGW
A0A2K6ECR0_MCL1-02      -----------GVQRNHETAFQG------WVCGVLPCRGPRRWHQKCA--
A0A2K6DS18_BCL2A1-      -----------LLRQRIAPDVDTYKEISYFVAEFIM-NNTGEWIRQNGGW
A0A2K6DS18_BCL2A1-      -----------LLRQRIAPDVDTYKEISYFVAEFIM-NNTGEWIRQNGGW
A0A2K6EA59_BCL2L2-      -----------SVNKEMEPLVGQVQE---WMVAYLE-TRLADWIHSSGGW
A0A2K6EA59_BCL2L2-      -----------SVNKEMEPLVGQVQE---WMVAYLE-TRLADWIHSSGGW
A0A2K6B2D9_BCL2L10      GFQPRLKEQEGDVARDCQRLVALLSS---RLAG-----QHRAWLQAQGGW
A0A2K6ECR0_MCL1-03      -----------NQESCIEPLAESITD---VLVR-----TKRDWLVKQRGW
                                                      :           *       

A0A2K6CIX3_BCL2-01      DA------------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2K6DS18_BCL2A1-      EN------------------------------------------------
A0A2K6DS18_BCL2A1-      GK------------------------------------------------
A0A2K6EA59_BCL2L2-      ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKM
A0A2K6EA59_BCL2L2-      AE------------------------------------------------
A0A2K6B2D9_BCL2L10      DG------------------------------------------------
A0A2K6ECR0_MCL1-03      DG------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      -----------FVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYL
A0A2K6ECR0_MCL1-02      ----------------AGFCRCCWSRSWFGISNKIALL------------
A0A2K6DS18_BCL2A1-      ----------------GFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC-
A0A2K6DS18_BCL2A1-      ---------------------------WHNHMPM---LVESVAHKKKKMA
A0A2K6EA59_BCL2L2-      EADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAY
A0A2K6EA59_BCL2L2-      -------FTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAF
A0A2K6B2D9_BCL2L10      -------FCHFFRSPFPL----------AFWRKLLIQAFLACLLATAFGY
A0A2K6ECR0_MCL1-03      -------FVEFFHVEDLE----------GGIRNVLLAFAGVAGVGAGLAY
                                                                          

A0A2K6CIX3_BCL2-01      GHK-----------------------------------------------
A0A2K6ECR0_MCL1-02      --------------------------------------------------
A0A2K6DS18_BCL2A1-      --------------------------------------------------
A0A2K6DS18_BCL2A1-      L-------------------------------------------------
A0A2K6EA59_BCL2L2-      IEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYR
A0A2K6EA59_BCL2L2-      F-------------------------------------------------
A0A2K6B2D9_BCL2L10      L-------------------------------------------------
A0A2K6ECR0_MCL1-03      L-------------------------------------------------
                                                                          

A0A2K6CIX3_BCL2-01      ---------------------------------------
A0A2K6ECR0_MCL1-02      ---------------------------------------
A0A2K6DS18_BCL2A1-      ---------------------------------------
A0A2K6DS18_BCL2A1-      ---------------------------------------
A0A2K6EA59_BCL2L2-      ARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A2K6EA59_BCL2L2-      ----------------------------------ASK--
A0A2K6B2D9_BCL2L10      ----------------------------------WTRLL
A0A2K6ECR0_MCL1-03      ----------------------------------IR---
                                                               

© 1998-2020Legal notice