Dataset for protein Bcl-xL of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREV
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
                                                                                

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
****************************.  *.   : :.* * : : *:     :  :.:            
VLVSRIAAWMATYLNDHLEPWIQENGGWdtfVelygnnaaAeSrkgqeRfnrwfltgmtvagvvllgslfsrk
                            sla sprlkfsg i ahykl lpcsrhspasas------------
© 1998-2020Legal notice