Dataset for protein Bcl-xL of organism Macaca mulatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F7ZJK5_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A5F7ZJK5_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A5F7ZJK5_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A5F7ZJK5_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A5F7ZJK5_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
                        **************************************************

A0A5F7ZJK5_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A5F7ZJK5_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A5F7ZJK5_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A5F7ZJK5_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A5F7ZJK5_BCL2L1-      INGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                        **************************************************

A0A5F7ZJK5_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A5F7ZJK5_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A5F7ZJK5_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A5F7ZJK5_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A5F7ZJK5_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        **************************************************

A0A5F7ZJK5_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWSLAVSPRLKFSG
A0A5F7ZJK5_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A5F7ZJK5_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A5F7ZJK5_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A5F7ZJK5_BCL2L1-      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                        **************************************.  *.   : :.

A0A5F7ZJK5_BCL2L1-      AISAHYKLRLPCSRHSPASAS------------
A0A5F7ZJK5_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A5F7ZJK5_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A5F7ZJK5_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
A0A5F7ZJK5_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
                        * * : : *:     :  :.:            

© 1998-2020Legal notice