Dataset for protein Bcl-w of organism Lynx canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.*:*. : . ...  .   *..  * ***  .***.....   .    .:*:*.      .:*  :    * . :: 
MAtpAsApdtrglvggrvsyplRrrhyVpGAG--pGEGppggplhygnrleseElEt------seLllqphvtPgseqqr
  aa a aaaaaaaadfgggkg qkgl c   gea   aaadagdqamgaagd f prfrrtfed aaelepe epaeep

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :     * **. *      . *.    *.   * :*  * :::                    *************
ptqvspplfqG-GPnwG------vpGpeleeEsvnvEmePlvGqvqe-------------------wELEAIKARVREME
frpradegap p  gs rlvaffaf aaeca pglk gd gd aiedwmvayletrladwihssggp             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
EEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
HPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRG
                                                                                

       330      
....:....|....:.
****************
RVYRGRARATSWYSPY
                
© 1998-2020Legal notice