Dataset for protein Bcl-w of organism Lynx canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667I624_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A667I624_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
                        **:.*:*. : . ...  .   *..  * ***  .***.....   .   

A0A667I624_BCL2L2-      AGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNWGRLV
A0A667I624_BCL2L2-      ESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSG---
                         .:*:*.      .:*  :    * . ::     :     * **. *   

A0A667I624_BCL2L2-      AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELE
A0A667I624_BCL2L2-      ---APGPEEEEEPGLVEGDPGDGAIED-------------------PELE
                           . *.    *.   * :*  * :::                    ***

A0A667I624_BCL2L2-      AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEAD
A0A667I624_BCL2L2-      AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEAD
                        **************************************************

A0A667I624_BCL2L2-      ARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEF
A0A667I624_BCL2L2-      ARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEF
                        **************************************************

A0A667I624_BCL2L2-      SDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
A0A667I624_BCL2L2-      SDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRART
                        **************************************************

A0A667I624_BCL2L2-      TNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A667I624_BCL2L2-      TNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                        ************************************

© 1998-2020Legal notice