Dataset for protein BCL-2-like of organism Jaculus jaculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           . :. :::     : .                                                     
---t--tsydnrelvvdyltyklsqkgyv-------------------------------------------------ag
mmm-ptsgqyvhsiarnfvqcvwrerslswdasqvssvtpnrtpapgifstqsgnettsavprnpswrtvpspavngp--
 ahagcmfpst a  q  ih   q p  c   gdfgdaeega e  e  gsepemd p  ingd aahlsdp  aacgt 
  a daeaa      a   g        a                                               aa  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .  .        :: .   * .:.. . .  : ::      :   *   *  * :: * .*  ****:*::* **..
pspspaa------rvvhqalrsAgdefetryrryfsdltsqlh-tpgtArqrFtqVveelFrdG-vNWGRiVafFvFGgv
hlsglvsrevipmpplqlvmfq qkdvsrnlkptlenmsvt--vsifs yis nt snke qg ip    l ti s  aa
 ge kdp      dl kkta e      l f  d aefea   l  dd qgi  m  e   i         e    
 a           aa      a      k    a    a    i                             a    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:  :   .: .  *.   .:  ::. ::  .   **...***   *   :                              
lcvesvnkemsplVd---qiaswmteylnthlhtWIqsnGGWdt-Fvelygpga-------r-lf---wlslrt-ltgal
mlkklprrqtqvd stnervslfvvtfitrrtgp  rqs   eng tkkfentvleesrkg-r--ngs------v----v
  a   dq  e g   n qe  aa  enn ee  he    ae  ia   dnsaa a   qprrefn avvkwl slmt
          d                  d  ad   d     a                  e  d g      f     

       250     
....:....|....:
 :.. :        :
-vggvvtlgaffssk
dlaaliwvmsyylrq
a   h le lllgk 
    c       ah 
© 1998-2022Legal notice