Dataset for protein BCL-2-like of organism Jaculus jaculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5L8K1_BCL2A1-      --MTDCEFAYVHSLAQDYLQCVWQEPSLC---------------------
A0A8C5L5C6_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYV---------------------
A0A8C5JYS0_BCL2-01      MAHAGTTGYDNREIVRNYIHYKLSQRGYAWDAGDVGSATPGATPAPGIFS
A0A8C5NZI4_BCL2L1-      ------MSQSNRELVVDFLTYKLSQKGYSW--SQFSDVEENRTEAPE--G
                                   . :. :::     : .                       

A0A8C5L8K1_BCL2A1-      ------------------------------PAPSKAS------RLLQKVA
A0A8C5L5C6_BCL2L2-      --------------------------CGAGPGEGPAA------DPLHQAM
A0A8C5JYS0_BCL2-01      SQPGNDTTSAVPRDPAARTSPPPAAAAPAGPLPGPVP------PVVHLTL
A0A8C5NZI4_BCL2L1-      TESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAAVKQAL
                                                         .  .        :: . 

A0A8C5L8K1_BCL2A1-      FSAQKEVEKNLKPYLENFEVT---SIDDARIIFNQVMEKEFEDGIINWGR
A0A8C5L5C6_BCL2L2-      RAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGR
A0A8C5JYS0_BCL2-01      RQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDG-VNWGR
A0A8C5NZI4_BCL2L1-      REAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGR
                          * .:.. . .  : ::      :   *   *  * :: * .*  ****

A0A8C5L8K1_BCL2A1-      IVTIFAFGGVLLKKLPRQQTDLDVDTNEQISSFVAEFITNNTGEWIRQNG
A0A8C5L5C6_BCL2L2-      LVAFFVFGAALCAESVNKEMEPLVG---QVQEWMVAYLETRLADWIHSSG
A0A8C5JYS0_BCL2-01      IVAFFEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNG
A0A8C5NZI4_BCL2L1-      IVAFFSFGGALCVESVDKEMQVLVS---RIASWMTTYLNDHLEPWIQENG
                        :*::* **..:  :   .: .  *.   .:  ::. ::  .   **...*

A0A8C5L8K1_BCL2A1-      GWENGFIKKFEPTS-------------GWLVL-------LDVAGHIWEML
A0A8C5L5C6_BCL2L2-      GWAE-FTALYGDGALEEA---RRLREGNWASVRTVLTGAVALGALVTVGA
A0A8C5JYS0_BCL2-01      GWDA-FVELYGPGV-------RPLFDFSWLSLKTLLSLAL-VGACVTLGA
A0A8C5NZI4_BCL2L1-      GWDT-FVELYGNNAAAESRKGQERFN------RWFLTGMT-VAGVVLLGS
                        **   *   :                               :.. :    

A0A8C5L8K1_BCL2A1-      FYLKQ
A0A8C5L5C6_BCL2L2-      FFASK
A0A8C5JYS0_BCL2-01      YLGHK
A0A8C5NZI4_BCL2L1-      LFSRK
                            :

© 1998-2022Legal notice