Dataset for protein BCL-2-like of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
           .  .     :                                                           
 amngrtaglk ai aklng vl                                                         
  hadcegyfi  q  iq                                                            
        r      m   h                                                            

        90       100       110       120       130       140       150       160
       qvf p  cvdppe-ml-pa--mspeeildgyegeplgkrravlpllelvgec-k---adga-pstp pppee 
         p    ep ktdvgaqsvgfsvqpg fssqp  htpaa tsp pppa p-- -  v----p      kv   
                 ag      p    g                         ia      l  v            

       170       180       190       200       210       220       230       240
                                         :.   * ..               :.       :  *  
delyrqsleiisrylreqatgskdakplrgsgaasrkaletmkrvl gvqrnhett-qgmlrk-dvknesdvkrltr mv
                                       ln  af  n st-f--- ---aa- -lslfd rti st se
                                       k   q   d dvw-w d ae --     ad  qg    d
                                           p                s                 

       250       260       270       280       290       300       310       320
  * .*  ***.:*::: **. :            :     :   :          *: .. **                
hv sg pt   hl tliv  avvakhlkninqepcigsdeqvqesitev-vdtkrd lvssr  ------f----le---
ke q  im       ile   fmvak lsrrissa e   plsyfvvd-ietr-at  hkq   eg taf-hvgd-gfvk
   e             a      m   re  a   d   n  l  -af ---a-e  r   an     srenm-ali
                                        e      -  mnn h        e     rd     a 

       330       340       350     
rlrpks----n-llaft kaawe    v -aylir
 fe    wlt-lrvvlq crr        afkqyy
       n dfc t g    m           as 
© 1998-2022Legal notice