Dataset for protein BCL-2-like of organism Ictidomys tridecemlineatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287DCH9_MCL1-02      ------MFGLKRNAVIGLNLYCG---------------------------
A0A287DCH9_MCL1-01      ------MFGLKRNAVIGLNLYCGGAGLGASGGATPPGAQLLAAEKEAAAR
I3MCZ7_BCL2A1-01        --MNDCEFRFIHTLAQDYLQHVL---------------------------
A0A287CZ07_BCL2L1-      ------MSQSNRELVVDFLSY-----------------------------
I3MUP5_BCL2L1-02        ------MSQSNRELVVDFLSY-----------------------------
I3MUP5_BCL2L1-03        ------MSQSNRELVVDFLSY-----------------------------
I3MUP5_BCL2L1-01        ------MSQSNRELVVDFLSY-----------------------------
I3MVK9_BCL2-01          MAHAGRTGYDNREIVMKYIHY-----------------------------
A0A287D9B3_BCL2L2-      -MATPASAPDTRALVADFVGY-----------------------------
A0A287D9B3_BCL2L2-      -MATPASAPDTRALVADFVGY-----------------------------
                                   .  .     :                             

A0A287DCH9_MCL1-02      -----------------------GAEVPDVTATPARRLFFAPTYCVSPPE
A0A287DCH9_MCL1-01      REAGGGEAAQPPSARRVARPVPIGAEVPDVTATPARRLFFAPTYCVSPPE
I3MCZ7_BCL2A1-01        -------------------------------------QVPQRGSSPSKTS
A0A287CZ07_BCL2L1-      -------------------------------------KLSQKGYSWSQFS
I3MUP5_BCL2L1-02        -------------------------------------KLSQKGYSWSQFS
I3MUP5_BCL2L1-03        -------------------------------------KLSQKGYSWSQFS
I3MUP5_BCL2L1-01        -------------------------------------KLSQKGYSWSQFS
I3MVK9_BCL2-01          -------------------------------------KLSQRGYEWDAGD
A0A287D9B3_BCL2L2-      -------------------------------------KLRQKGY------
A0A287D9B3_BCL2L2-      -------------------------------------KLRQKGY------
                                                              .           

A0A287DCH9_MCL1-02      KMEAPAAAMSPEEELDGYEPEPLGKRPAVLPLLELVGEAAKSPGADGSLP
A0A287DCH9_MCL1-01      KMEAPAAAMSPEEELDGYEPEPLGKRPAVLPLLELVGEAAKSPGADGSLP
I3MCZ7_BCL2A1-01        KVLQNVAFSVQ---------------------------------------
A0A287CZ07_BCL2L1-      DVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAINGATGHSSSLDAR
I3MUP5_BCL2L1-02        DVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAR
I3MUP5_BCL2L1-03        DVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAR
I3MUP5_BCL2L1-01        DVEENRTEAPEGTESEVETPSAINGNPSWHLADSPAVNGATGHSSSLDAR
I3MVK9_BCL2-01          VGAASPGAAPGPGIFSSQPGSHTPAARTSPPPPPAAPAAAAGPVLSPVP-
A0A287D9B3_BCL2L2-      -------------------------------------VCGAGPGEGPAA-
A0A287D9B3_BCL2L2-      -------------------------------------VCGAGPGEGPAA-
                                                                          

A0A287DCH9_MCL1-02      STPPPAEEEDDELYRQSLEIISRYLREQATGSKDAKPLRGSGAASRKALE
A0A287DCH9_MCL1-01      STPPPAEEEDDELYRQSLEIISRYLREQATGSKDAKPLRGSGAASRKALE
I3MCZ7_BCL2A1-01        -----KEVE----------------------------------------K
A0A287CZ07_BCL2L1-      EVIPMAAVK----------------------------------------Q
I3MUP5_BCL2L1-02        EVIPMAAVK----------------------------------------Q
I3MUP5_BCL2L1-03        EVIPMAAVK----------------------------------------Q
I3MUP5_BCL2L1-01        EVIPMAAVK----------------------------------------Q
I3MVK9_BCL2-01          -----PVVH----------------------------------------L
A0A287D9B3_BCL2L2-      -----DPLH----------------------------------------Q
A0A287D9B3_BCL2L2-      -----DPLH----------------------------------------Q
                                                                          

A0A287DCH9_MCL1-02      TLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNW
A0A287DCH9_MCL1-01      TLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHVFSDGVTNW
I3MCZ7_BCL2A1-01        NLKPFLDNFDV--------------VSADTARTIFNQVMEKEFEDGIMNW
A0A287CZ07_BCL2L1-      ALREAGDEFELWYWRAFSDLTSQLHITLGTAYQSFEQVVNELFRDGV-NW
I3MUP5_BCL2L1-02        ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NW
I3MUP5_BCL2L1-03        ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NW
I3MUP5_BCL2L1-01        ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV-NW
I3MVK9_BCL2-01          TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGV-NW
A0A287D9B3_BCL2L2-      AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP-NW
A0A287D9B3_BCL2L2-      AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP-NW
                         :.   * ..               :.       :  *    * .*  **

A0A287DCH9_MCL1-02      GRIVTLISFGAFVAKHLKSINQESCIE---PLAESITDVLVRTKRDWLVK
A0A287DCH9_MCL1-01      GRIVTLISFGAFVAKHLKSINQESCIE---PLAESITDVLVRTKRDWLVK
I3MCZ7_BCL2A1-01        GRIVTIFAFGGVLVKKLLRERIAPAVDSDEEISYFVAEFIMNNAGEWIRQ
A0A287CZ07_BCL2L1-      GHIVAFLSFGGALCMESVDKEMQVLVS---RIASWM---------PWIQE
I3MUP5_BCL2L1-02        GRIVAFFSFGGALCVESVDKEMQVLVS---RIASWMATYLNDHLEPWIQE
I3MUP5_BCL2L1-03        GRIVAFFSFGGALCVESVDKEMQVLVS---RIASWMATYLNDHLEPWIQE
I3MUP5_BCL2L1-01        GRIVAFFSFGGALCVESVDKEMQVLVS---RIASWMATYLNDHLEPWIQE
I3MVK9_BCL2-01          GRIVAFFEFGGVMCVESVNREMSPLVD---NIALWMTEYLNRHLHTWIQD
A0A287D9B3_BCL2L2-      GRLVAFFVFGAALCAESVNKEMEPLVG---QVQEWMVAYLETRLADWIHS
A0A287D9B3_BCL2L2-      GRLVAFFVFGAALCAESVNKEMEPLVG---QVQEWMVAYLETRLADWIHS
                        *.:*::: **. :            :     :   :          *: .

A0A287DCH9_MCL1-02      QRGWDGFVEFFHVEDLE---------GGIRNVLLAFAGVAGVG----AGL
A0A287DCH9_MCL1-01      QRGWDGFVEFFHVEDLE---------GGIRNVLLAFAGVAGVG----AGL
I3MCZ7_BCL2A1-01        NGGWEN----------GFVKKFEPKSGWLTFLGVTGQICEMLS------L
A0A287CZ07_BCL2L1-      NGGWDTFVELYRNNAAAESRKGQERFNRWFLTGMTVAGVVLLG------S
I3MUP5_BCL2L1-02        NGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLG------S
I3MUP5_BCL2L1-03        NGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLG------S
I3MUP5_BCL2L1-01        NGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLG------S
I3MVK9_BCL2-01          NGGW--------------------------------VGARRVE-------
A0A287D9B3_BCL2L2-      SGGW-----LFSRGNMGALI------GGWDSC----AGKEAWG-------
A0A287D9B3_BCL2L2-      SGGWAEFTALYGDGALEEARRLRE--GNWASVRTVLTGAVALGALVTVGA
                        . **                                              

A0A287DCH9_MCL1-02      AYLIR
A0A287DCH9_MCL1-01      AYLIR
I3MCZ7_BCL2A1-01        LKQYY
A0A287CZ07_BCL2L1-      LFSRK
I3MUP5_BCL2L1-02        LFSRK
I3MUP5_BCL2L1-03        LFSRK
I3MUP5_BCL2L1-01        LFSRK
I3MVK9_BCL2-01          -----
A0A287D9B3_BCL2L2-      -----
A0A287D9B3_BCL2L2-      FFASK
                             

© 1998-2020Legal notice