Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------msqdnrelvvdflgyklsqkgy-w--gs----------------------------------------------
mmatpa-apstgakrakyisln-rcr-as-sa--ggatrpggrllatekeasarreigggeagaviggsagasppstltp
 ahagrs--mf-li-navvh-- y-gq-glgqfdvar           m                               
 vmqdctgy--y--am----cv -i- pesdpspc                                             
  dplvefgyiarpl-ertq l qdp fvc l k                                              
  n r prttm d  q   e   a y  m    y                                              
       me a    r                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------tp---------------vvnaa
dsrrvarpppigaevpdvtatparllffaptrraapleemdveenrteapegteseme--saingrpswhladspa--gg
                                        eppgaapapspfssqpghekepaasndavartspl-cg--
                                        aagapdaimgieerlday  h lgk spalplle qtpse
                                        lgatseg tr  g  l t    svl e        igey 
                                             g                  r           el  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pghsssld-----p-------------------------------------------vhqalreagdeferryrrafsdl
t-------arevp-maaeeedelyrqsleiisrylreqatgakdtkpmgrsgatsrklketmqav--gvqlnfettlqgm
-negpaaslspti vtptpdsr              varppp        e paadpall--krlafd-stah--dcaec
nsaaagpappss  p e                                        ---v -qihrsl-kevvk--ksp
a trtdg fgl   s l                                        tsrs  n-  - f---xgn iy-
  mvilf   a                                              sw    t      s l    gtw
                                                               -             -- 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tsqlhitp-gtayqsfeqvvnelfrdg-vnwgrivaffsfggalc------------------vesvnkemeplvs---r
lakvdvknvesdqkrltr-md-v-sg-vp----l-tliv--afvaergplvtarwkkwgfqprkhlkdinqqvcigtykq
arrfnlv- fd-rg--st seh-pq-sitt   - ---- e----                  a---t---ss--d   p
sdn----s -- v-l a- --ke -p p-r   v  ive a vmi                  -kel-rqi--dce   n
gny gh a dm -tv -d  i   er  i         a   i l                  l  qrqdvar a-   -
--- e    l  ds  n       c   r         t   t                        eg h e  q   e
vcg                                                                        a   g
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
iaewmttylnrhlrdwiqenggw---------------------------------------------------------
vqasiaav-edqkep-lhssr--lswwtfcsmhlrviiteilswggsilsspslgeleaikarvremeeeaeklkelqne
l-l--ve-ivtt-at -vkq-   dqiceaeaade  csdggddcdpaaplgdaespdlhlnptpvwclri aatlwdls
-s-fv-df ---th- f---                                                            
fvylls-r mnnh-e  rd                                                             
 crccws   g  ga   q                                                             
              s   a                                                             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------dtfvelyg--a-e---------------------------------lltgmtvagvvllgalf
vekqmnmspppgnphlq-g------nn-l-esrkgqerfnrwygataeeleahfhgggsvrnvf----------aglsyl
cfhfcsqlsglcg    a-ptaffhvedaaaaarlryvggndttsllrwpvkttflcagintl-tafaglgalg------
                 vetrimsidgkmsqdwssiaswrv llifvqvsnslptwrptmvpttsgavassktltsftfv
                 tasqstpqehigrptparprg hg fch gptmmpkgepksqlmrgvilcwlillhpkvwrti
                  s frians  cl  g alg   f     fnghlnfa  eklwkwfpdfsdkftsfmyptlry
                  r  d  al         d          ekdffh     t hgqahevtlhtnrsswkskqt
                  p      h                     ca          afm  hsvgvnknmis id s
                                                             i   cmiekeekhn     
                                                                 he   c iam     
                                                                  d       f     
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sr------------------------------------------------------------------------------
--kakvslgtylalkeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprgrvyrgrar
issdcitvrasqghdtfsqeel gpwpgyqnall                                              
gflgdepwsllpsall                                                                
amettghnpgianqg                                                                 
ea lqtfi f  kpe                                                                 
lv f   a    f                                                                   
yp                                                                              
qe                                                                              
k                                                                               
h                                                                               
c                                                                               

        
....:...
        
--------
atswyspy
        
        
        
        
        
        
        
        
        
        
© 1998-2022Legal notice