Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------mgqsnrelvvdflsyklsqkgyswsqfs----------------------------------------------
mahagrfsykrn-v----ihln------g--ag-vgaappggrllatekeasarreigggeagaviggsagasppstltp
 mtdcmt-ld--aiamky-g-- ycr aeld--dg  tr         m                               
     e- --y  - q   -cv   g  - g                                                 
         i         q        m                                                   
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------dvpenrteasegte--metpsaingrpswhladspavnga
dsrrvarpppigaevpdvtatparllffaptrraapleemaaeapgifspqp--seg----p---n--v-----l-----
                                        e---adaim-peerld-hekh-aas-dp-artsp-qtpag
                                        -iaq-----r--s  lay  e lgk ea lplle vgese
                                        qg gs sgp ktg    t    s r          i g  
                                        l     gat                               
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tghsssldarevppmaav------------------------------------------tLreagdeferryrrafsdm
--------l---i-----kqdelyrqsleiisrylreqatgakdtkpmgrsgatsrkalea-qrvafgvqlnhetdlqgl
pnaaagps-spt- vvhleesr              varppp                  v -q---d-skev-kn-aec
n tvtdga pss  pteepd                                        -  n   s ---- -- ks-
a   i    gl   s lt                                             -   -         --w
          a                                                                     
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tsqlhitpgtayqs-feqvvnelFrdgv-nWgrivaffsfggalcvesvdkemqvlvs---riaawmttylnrhlepwiq
lrkvdlkneddvkrllsr-mehv-s---t------tlie--afvakhlktinqepcidtykpl-esiaev-vdtkrd-lv
sdn-nvvsf-trgt yats-i-epefsiis lslk----le-vm-----nr--ss--e   n-sl---d-i----ht --
---p----v -are -np  -k- -r prr      ila a --i k l--qi--da-   -fc-fvw-f mnnt-- fr
vmr r pm-  fv-  g-  rp  d                 i      rq hae  a   e  ycc s      ge   
 cg    gq  --   -       c                                    g  r           s   
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
enggw--------------------------------------------------------------------------d
kqr--ldwwcfcsahlrviitdggdwggpilplgsagspdlhlnptpvwclrieaatlwdlscfhfcsqlsglcgphlq-
d--                                                                            v
-                                                                              t
q                                                                              l
                                                                                
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
                                                                        
tfvely-----------------------------------srkgqerfnrwfltgmtvaavvllgslfsrk
g---ffnsnacsptpaalattillpasmnlttlggnnaaaehvedl-ggi-nv-lafagvggiga-laylir
-alg--                           spsmrplf-----s---l--v-------c-t-sa-l---
atqddv                            lghvwwhdfswevlktwlssalvgigi-r-na-y-ghe
ym                                t  knvmvkvpdptssmmthveslalkknsmkiikqyc
e                                    gkt thtf aslrf mfrsiv k eem  f  kk 
                                     ecg qcf   k g  l hfch h   k      a 
                                         n d        i    e e   f        
                                         e                              
© 1998-2022Legal notice