Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B4E1X9_BCL2A1-01       -------------------MTDCEFGYIYRLAQDYL--------------
Q16548_BCL2A1-01       -------------------MTDCEFGYIYRLAQDYL--------------
B4DU51_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEMEAPAADAIMS
C8YZ26_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL--------------
Q07820_MCL1-04         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL--------------
B4DLY8_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL--------------
B4DG83_MCL1-01         -------------------MEAPAADAIMSPEEELD--------------
B4E3L8_MCL1-01         -------------------MEAPAADAIMSPEEELD--------------
A9QXG9_BCL2-01         -----------------------------MAHAGRT--------------
Q9HD36_BCL2L10-02      -----------------------------MVDQLRE--------------
                                                                         

B4E1X9_BCL2A1-01       --------------------------------------------------
Q16548_BCL2A1-01       --------------------------------------------------
B4DU51_MCL1-01         PEEELDGYEPEPLGKRPAVLPLLEL-----VGESGNNTSTDGSLPL----
C8YZ26_MCL1-01         --------------------------------------------------
Q07820_MCL1-04         --------------------------------------------------
B4DLY8_MCL1-01         ------ATEKEASARRE-------------IGGGEAGAVIGGSAGA----
B4DG83_MCL1-01         ------GYEPEPLGKRPAVLPLLEL-----VGESGNNTSTDGSLPS----
B4E3L8_MCL1-01         ------GYEPEPLGKRPAVLPLLEL-----VGESGNNTSTDGSLPS----
A9QXG9_BCL2-01         ------GYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSS
Q9HD36_BCL2L10-02      ------RTTMADPLRERTELLLADY-----LGYCAREPGTPEPAPS----
                                                                         

B4E1X9_BCL2A1-01       -----------------------------------QCVLQIPQPGSGPSK
Q16548_BCL2A1-01       -----------------------------------QCVLQIPQPGSGPSK
B4DU51_MCL1-01         ----TPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRK
C8YZ26_MCL1-01         -------------------------------ATGAKDTKPMGRSGATSRK
Q07820_MCL1-04         -------------------------------ATGAKDTKPMGRSGATSRK
B4DLY8_MCL1-01         ----SPPSTLTPDSR-------------RVARPPPKDTKPMGRSGATSRK
B4DG83_MCL1-01         ----TPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRK
B4E3L8_MCL1-01         ----TPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRK
A9QXG9_BCL2-01         QPGHTPHPAASRDPV---------ARTSPLQTPAAPGAAAGPALSPVPPV
Q9HD36_BCL2L10-02      ----TPEAAVLRSAA---------AR------------------------
                                                                         

B4E1X9_BCL2A1-01       TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDG
Q16548_BCL2A1-01       TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDG
B4DU51_MCL1-01         ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDG
C8YZ26_MCL1-01         ALETLRRVGDGVQRNHETAFQGMLRRLDIKNEDDVKSL-SRVMIHVFSDG
Q07820_MCL1-04         ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDG
B4DLY8_MCL1-01         ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDG
B4DG83_MCL1-01         ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDG
B4E3L8_MCL1-01         ALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDS
A9QXG9_BCL2-01         VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF-ATVVEELFRDG
Q9HD36_BCL2L10-02      ----LRQIHRSFFSAY---LGYPGNRFELVALMADSVL-SD------SPG
                           *..   ..       :     .. :        :           .

B4E1X9_BCL2A1-01       IINWGRIVTIFAFEGILIKKL---------------LRQQIAPDVDTYKE
Q16548_BCL2A1-01       IINWGRIVTIFAFEGILIKKL---------------LRQQIAPDVDTYKE
B4DU51_MCL1-01         VTNWGRIVTLISFGAFVAKH----------------LKTINQESC--IEP
C8YZ26_MCL1-01         VTNWGRIVTLISFGAFVAKH----------------LKTINQESC--IEP
Q07820_MCL1-04         VTNWGRIVTLISFGAFVAKH----------------LKTINQESC--IEP
B4DLY8_MCL1-01         VTNWGRIVTLISFGAFVAKH----------------LKTINQESC--IEP
B4DG83_MCL1-01         VTNWGRIVTLISFGAFVAKH----------------LKTINQESC--IEP
B4E3L8_MCL1-01         VTNWGRIVTLISFGAFVAKH----------------LKTINQESC--IEP
A9QXG9_BCL2-01         V-NWGRIVAFFEFGGVMC------------------VESVNREMSPLVDN
Q9HD36_BCL2L10-02      P-TWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQR
                         .***:*::. * . :                   :           . 

B4E1X9_BCL2A1-01       ISYFVAEFIMNNTGEWIRQNGGWVC------------VMEK---------
Q16548_BCL2A1-01       ISYFVAEFIMNNTGEWIRQNGGWEN------------GFVKKFEPKSGWM
B4DU51_MCL1-01         LAESITDVLVRTKRDWLVKQRGWDG-----------------------FV
C8YZ26_MCL1-01         LAESITDVLVRTKRDWLVKQRGWDG-----------------------FV
Q07820_MCL1-04         LAESITDVLVRTKRDWLVKQRGWDG-----------------------FV
B4DLY8_MCL1-01         LAESITDVLVRTKRDWLVKQRGWDG-----------------------FV
B4DG83_MCL1-01         LAESITDVLVRTKRDWLVKQRGWDG-----------------------FV
B4E3L8_MCL1-01         LAESITDVLVRTKRDWLVKQRGWDG-----------------------FV
A9QXG9_BCL2-01         IALWMTEYLNRHLHTWIQDNGGWDA-----------------------FV
Q9HD36_BCL2L10-02      LVALLSSRLMGQHRAWLQAQGGWVSTRRTPGHGAGRAAGKRPRGWHGWLL
                       :   ::. :      *:  : **                           

B4E1X9_BCL2A1-01       -FFIVL------------SCEIEIENFLAS--------------------
Q16548_BCL2A1-01       TFLEVT------------GKICEMLSLLKQYC------------------
B4DU51_MCL1-01         EFFHVE------------DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
C8YZ26_MCL1-01         EFFQVE------------DLEGGIRNVLLAFAGVAGVGAGLAYLKR----
Q07820_MCL1-04         EFFHVE------------DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
B4DLY8_MCL1-01         EFFHVE------------DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
B4DG83_MCL1-01         EFFHVE------------DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
B4E3L8_MCL1-01         EFFHVE------------DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
A9QXG9_BCL2-01         ELYGPSMRPLF-------DFSWLSLKTLLSLALVGACITLGAYLSHK---
Q9HD36_BCL2L10-02      SLLQDPLSTGFLEKTAGPGFSVMLVNNSLHLSLDTIIMSFKTFNPLLPAQ
                        :                .      .                        

B4E1X9_BCL2A1-01       -
Q16548_BCL2A1-01       -
B4DU51_MCL1-01         -
C8YZ26_MCL1-01         -
Q07820_MCL1-04         -
B4DLY8_MCL1-01         -
B4DG83_MCL1-01         -
B4E3L8_MCL1-01         -
A9QXG9_BCL2-01         -
Q9HD36_BCL2L10-02      L
                        

© 1998-2020Legal notice