Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

36 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P10415_BCL2-03        --------------------------------------------------
P10415_BCL2-09        --------------------------------------------------
Q07820_MCL1-05        --------------------------------------------------
Q16548_BCL2A1-01      -MTDCEFGYIYR-LAQDYLQCVL---------------------------
Q16548_BCL2A1-03      -MTDCEFGYIYR-LAQDYLQCVL---------------------------
Q16548_BCL2A1-02      -MTDCEFGYIYR-LAQDYLQCVL---------------------------
Q07817_BCL2L1-02      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-14      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-12      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-15      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-05      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-01      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-03      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-04      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-06      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-07      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-08      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-09      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-10      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-11      ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
P10415_BCL2-08        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPG---------
P10415_BCL2-06        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPG---------
P10415_BCL2-07        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPG---------
A9QXG9_BCL2-01        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPG---------
P10415_BCL2-10        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPG---------
P10415_BCL2-04        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPG---------
P10415_BCL2-05        MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPG---------
B4DLY8_MCL1-01        -----MFGLKRNAV----IGLNLYCGGAG---------------------
B4DG83_MCL1-01        ----------------------------M---------------------
B4E3L8_MCL1-01        ----------------------------M---------------------
Q07820_MCL1-09        -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
Q07820_MCL1-03        -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
Q07820_MCL1-07        -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
B4DU51_MCL1-01        -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATRPGGRLLATEM-
C8YZ26_MCL1-01        -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATRPGGRLL-----
Q07820_MCL1-06        -----MFGLKRNAV----IGLNLYCGGAGLGAGSGGATRPGGRLL-----
                                                                        

P10415_BCL2-03        --------------------------------------------------
P10415_BCL2-09        --------------------------------------------------
Q07820_MCL1-05        --------------------------------------------------
Q16548_BCL2A1-01      --------------------------------------------------
Q16548_BCL2A1-03      --------------------------------------------------
Q16548_BCL2A1-02      --------------------------------------------------
Q07817_BCL2L1-02      --------------------------------------------------
Q07817_BCL2L1-14      --------------------------------------------------
Q07817_BCL2L1-12      --------------------------------------------------
Q07817_BCL2L1-15      --------------------------------------------------
Q07817_BCL2L1-05      --------------------------------------------------
Q07817_BCL2L1-01      --------------------------------------------------
Q07817_BCL2L1-03      --------------------------------------------------
Q07817_BCL2L1-04      --------------------------------------------------
Q07817_BCL2L1-06      --------------------------------------------------
Q07817_BCL2L1-07      --------------------------------------------------
Q07817_BCL2L1-08      --------------------------------------------------
Q07817_BCL2L1-09      --------------------------------------------------
Q07817_BCL2L1-10      --------------------------------------------------
Q07817_BCL2L1-11      --------------------------------------------------
P10415_BCL2-08        --------------------------------------------------
P10415_BCL2-06        --------------------------------------------------
P10415_BCL2-07        --------------------------------------------------
A9QXG9_BCL2-01        --------------------------------------------------
P10415_BCL2-10        --------------------------------------------------
P10415_BCL2-04        --------------------------------------------------
P10415_BCL2-05        --------------------------------------------------
B4DLY8_MCL1-01        --------------------------------------------------
B4DG83_MCL1-01        --------------------------------------------------
B4E3L8_MCL1-01        --------------------------------------------------
Q07820_MCL1-09        ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
Q07820_MCL1-03        ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
Q07820_MCL1-07        ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
B4DU51_MCL1-01        --------------------------------------------------
C8YZ26_MCL1-01        --------------------------------------------------
Q07820_MCL1-06        --------------------------------------------------
                                                                        

P10415_BCL2-03        --------------------------------------------------
P10415_BCL2-09        --------------------------------------------------
Q07820_MCL1-05        --------------------------------------------------
Q16548_BCL2A1-01      --------------------QIPQPGSGPSKTSR----------------
Q16548_BCL2A1-03      --------------------QIPQPGSGPSKTSR----------------
Q16548_BCL2A1-02      --------------------QIPQPGSGPSKTSR----------------
Q07817_BCL2L1-02      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-14      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-12      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-15      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-05      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-01      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-03      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-04      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-06      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-07      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-08      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-09      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-10      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-11      --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
P10415_BCL2-08        --------------------AAPAPGIFSSQP----GHTPHPAASRDPVA
P10415_BCL2-06        --------------------AAPAPGIFSSQP----GHTPHPAASRDPVA
P10415_BCL2-07        --------------------AAPAPGIFSSQP----GHTPHPAASRDPVA
A9QXG9_BCL2-01        --------------------AAPAPGIFSSQP----GHTPHPAASRDPVA
P10415_BCL2-10        --------------------AAPAPGIFSSQP----GHTPHPAASRDPVA
P10415_BCL2-04        --------------------AAPAPGIFSSQP----GHTPHPAASRDPVA
P10415_BCL2-05        --------------------AAPAPGIFSSQP----GHTPHPAASRDPVA
B4DLY8_MCL1-01        --------------------LGAGSGGATRPGGRLLATEKEASARRE---
B4DG83_MCL1-01        --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
B4E3L8_MCL1-01        --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-09        TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-03        TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-07        TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
B4DU51_MCL1-01        --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
C8YZ26_MCL1-01        --------------------------------------------------
Q07820_MCL1-06        --------------------------------------------------
                                                                        

P10415_BCL2-03        --------------------------------------------------
P10415_BCL2-09        --------------------------------------------------
Q07820_MCL1-05        --------------------------------------------------
Q16548_BCL2A1-01      --------------------------------------------------
Q16548_BCL2A1-03      --------------------------------------------------
Q16548_BCL2A1-02      --------------------------------------------------
Q07817_BCL2L1-02      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-14      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-12      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-15      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-05      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-01      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-03      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-04      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-06      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-07      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-08      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-09      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-10      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
Q07817_BCL2L1-11      LADSPAVNGATGHSSSLDAREVIPMAAVKQ--------------------
P10415_BCL2-08        RTSPLQTPAAPGAAAGPALSPVPPVVHL----------------------
P10415_BCL2-06        RTSPLQTPAAPGAAAGPALSPVPPVVHL----------------------
P10415_BCL2-07        RTSPLQTPAAPGAAAGPALSPVPPVVHL----------------------
A9QXG9_BCL2-01        RTSPLQTPAAPGAAAGPALSPVPPVVHL----------------------
P10415_BCL2-10        RTSPLQTPAAPGAAAGPALSPVPPVVHL----------------------
P10415_BCL2-04        RTSPLQTPAAPGAAAGPALSPVPPVVHL----------------------
P10415_BCL2-05        RTSPLQTPAAPGAAAGPALSPVPPVVHL----------------------
B4DLY8_MCL1-01        -----IGGGEAGAVIGGSAGASPPSTLTPDSR-------------RVARP
B4DG83_MCL1-01        PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4E3L8_MCL1-01        PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-09        PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-03        PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-07        PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4DU51_MCL1-01        PLLELVGESGNNTSTDGSLPLTPPPAEEEEDELYRQSLEIISRYLREQAT
C8YZ26_MCL1-01        ------------------------------------------------AT
Q07820_MCL1-06        ------------------------------------------------AT
                                                                        

P10415_BCL2-03        -----------------------------------------MNPRVPGQD
P10415_BCL2-09        -----------------------------------------------MED
Q07820_MCL1-05        -------MGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
Q16548_BCL2A1-01      --------------------VLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q16548_BCL2A1-03      --------------------VLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q16548_BCL2A1-02      --------------------VLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q07817_BCL2L1-02      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-14      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-12      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-15      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-05      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-01      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-03      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-04      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-06      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-07      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-08      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-09      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-10      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
Q07817_BCL2L1-11      --------------------ALREAGDEFELRYRRAFSDLTSQLHITPGT
P10415_BCL2-08        --------------------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
P10415_BCL2-06        --------------------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
P10415_BCL2-07        --------------------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
A9QXG9_BCL2-01        --------------------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
P10415_BCL2-10        --------------------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
P10415_BCL2-04        --------------------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
P10415_BCL2-05        --------------------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFT
B4DLY8_MCL1-01        PPKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
B4DG83_MCL1-01        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
B4E3L8_MCL1-01        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
Q07820_MCL1-09        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV------
Q07820_MCL1-03        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
Q07820_MCL1-07        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
B4DU51_MCL1-01        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
C8YZ26_MCL1-01        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRRLDIKNED
Q07820_MCL1-06        GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
                                                                        

P10415_BCL2-03        AFVELYGPSMRPLFDF---SWLSLKTLLSLA-------------------
P10415_BCL2-09        AFVELYGPSMRPLFDF---SWLSLKTLLSLA-------------------
Q07820_MCL1-05        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
Q16548_BCL2A1-01      TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTY
Q16548_BCL2A1-03      TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTY
Q16548_BCL2A1-02      TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTY
Q07817_BCL2L1-02      AYQS-FEQ------------------------------------------
Q07817_BCL2L1-14      AYQS-FEQ------------------------------------------
Q07817_BCL2L1-12      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-15      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-05      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-01      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-03      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-04      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-06      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-07      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-08      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-09      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-10      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
Q07817_BCL2L1-11      AYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--
P10415_BCL2-08        ARGR-FATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--
P10415_BCL2-06        ARGR-FATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--
P10415_BCL2-07        ARGR-FATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--
A9QXG9_BCL2-01        ARGR-FATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--
P10415_BCL2-10        ARGR-FATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--
P10415_BCL2-04        ARGR-FATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--
P10415_BCL2-05        ARGR-FATVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--
B4DLY8_MCL1-01        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
B4DG83_MCL1-01        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
B4E3L8_MCL1-01        DVKS-LSRVMIHVFSDSVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
Q07820_MCL1-09        ------------LPCRGPRRW---------------------HQECAA--
Q07820_MCL1-03        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
Q07820_MCL1-07        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
B4DU51_MCL1-01        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
C8YZ26_MCL1-01        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
Q07820_MCL1-06        DVKS-LSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE--
                                                                        

P10415_BCL2-03        --------------------------------------------------
P10415_BCL2-09        --------------------------------------------------
Q07820_MCL1-05        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
Q16548_BCL2A1-01      KEISYFVAEFIMNNTGEWIRQNGGW-------------------------
Q16548_BCL2A1-03      KEISYFVAEFIMNNTGEWIRQNGGW-------------------------
Q16548_BCL2A1-02      KEISYFVAEFIMNNTGEWIRQNGGW-------------------------
Q07817_BCL2L1-02      --------------------------------------------------
Q07817_BCL2L1-14      --------------------------------------------------
Q07817_BCL2L1-12      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-15      -RIAAWMATYLNDHLEPWIQENGGWLDWWCFCSAHLRVIITDGGDWGGPI
Q07817_BCL2L1-05      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-01      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-03      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-04      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-06      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-07      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-08      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-09      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-10      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
Q07817_BCL2L1-11      -RIAAWMATYLNDHLEPWIQENGGW-------------------------
P10415_BCL2-08        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
P10415_BCL2-06        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
P10415_BCL2-07        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
A9QXG9_BCL2-01        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
P10415_BCL2-10        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
P10415_BCL2-04        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
P10415_BCL2-05        -NIALWMTEYLNRHLHTWIQDNGGW-------------------------
B4DLY8_MCL1-01        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
B4DG83_MCL1-01        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
B4E3L8_MCL1-01        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
Q07820_MCL1-09        -GFCRCCWS------RSWF-------------------------------
Q07820_MCL1-03        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
Q07820_MCL1-07        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
B4DU51_MCL1-01        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
C8YZ26_MCL1-01        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
Q07820_MCL1-06        -PLAESITDVLVRTKRDWLVKQRGW-------------------------
                                                                        

P10415_BCL2-03        --------------------------------------------------
P10415_BCL2-09        --------------------------------------------------
Q07820_MCL1-05        -------------------------------------------------D
Q16548_BCL2A1-01      --------------------------------------------------
Q16548_BCL2A1-03      --------------------------------------------------
Q16548_BCL2A1-02      --------------------------------------------------
Q07817_BCL2L1-02      -------------------------------------------------D
Q07817_BCL2L1-14      -------------------------------------------------D
Q07817_BCL2L1-12      --------------------------------------------------
Q07817_BCL2L1-15      LPLGSAGSPDLHLNPTPVWCLRIEAATLWDLSCFHFCSQLSGLCGPHLQD
Q07817_BCL2L1-05      -------------------------------------------------D
Q07817_BCL2L1-01      -------------------------------------------------D
Q07817_BCL2L1-03      -------------------------------------------------D
Q07817_BCL2L1-04      -------------------------------------------------D
Q07817_BCL2L1-06      -------------------------------------------------D
Q07817_BCL2L1-07      -------------------------------------------------D
Q07817_BCL2L1-08      -------------------------------------------------D
Q07817_BCL2L1-09      -------------------------------------------------D
Q07817_BCL2L1-10      -------------------------------------------------D
Q07817_BCL2L1-11      -------------------------------------------------D
P10415_BCL2-08        -------------------------------------------------T
P10415_BCL2-06        -------------------------------------------------D
P10415_BCL2-07        -------------------------------------------------D
A9QXG9_BCL2-01        -------------------------------------------------D
P10415_BCL2-10        -------------------------------------------------V
P10415_BCL2-04        -------------------------------------------------V
P10415_BCL2-05        -------------------------------------------------L
B4DLY8_MCL1-01        -------------------------------------------------D
B4DG83_MCL1-01        -------------------------------------------------D
B4E3L8_MCL1-01        -------------------------------------------------D
Q07820_MCL1-09        --------------------------------------------------
Q07820_MCL1-03        -------------------------------------------------D
Q07820_MCL1-07        -------------------------------------------------D
B4DU51_MCL1-01        -------------------------------------------------D
C8YZ26_MCL1-01        -------------------------------------------------D
Q07820_MCL1-06        -------------------------------------------------D
                                                                        

P10415_BCL2-03        --------------------------------------------------
P10415_BCL2-09        --------------------------------------------------
Q07820_MCL1-05        GFVEFF-----------------------------------HVEDLEGGI
Q16548_BCL2A1-01      -------------------------------------GKWHNHTP-----
Q16548_BCL2A1-03      -------------------------------------VCVMEKFF-----
Q16548_BCL2A1-02      -------------------------------------ENGFVKKFEPKSG
Q07817_BCL2L1-02      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-14      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-12      -------------------------------------------VPDASFR
Q07817_BCL2L1-15      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-05      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-01      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-03      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-04      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-06      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-07      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-08      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-09      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-10      TFVELY----------------------------GNNAAAESRKGQERFN
Q07817_BCL2L1-11      TFVELY----------------------------GNNAAAESRKGQERFN
P10415_BCL2-08        ETQDLFNSNACSPTPAALATTILLPASMNLTTLGTSHKWTHTCDWLVTLS
P10415_BCL2-06        AFVELY---------------------------GPSMRPLFDFSWLSLKT
P10415_BCL2-07        AFVELY---------------------------GPSMRPLFDFSWLSLKT
A9QXG9_BCL2-01        AFVELY---------------------------GPSMRPLFDFSWLSLKT
P10415_BCL2-10        GALGDV---------------------------SLG--------------
P10415_BCL2-04        GALGDV---------------------------SLG--------------
P10415_BCL2-05        YM------------------------------------------------
B4DLY8_MCL1-01        GFVEFF-----------------------------------HVEDLEGGI
B4DG83_MCL1-01        GFVEFF-----------------------------------HVEDLEGGI
B4E3L8_MCL1-01        GFVEFF-----------------------------------HVEDLEGGI
Q07820_MCL1-09        --------------------------------------------------
Q07820_MCL1-03        GFVEFF-----------------------------------HVEDLEGGI
Q07820_MCL1-07        GFVEFF-----------------------------------HVEDLEGGI
B4DU51_MCL1-01        GFVEFF-----------------------------------HVEDLEGGI
C8YZ26_MCL1-01        GFVEFF-----------------------------------QVEDLEGGI
Q07820_MCL1-06        GFVEFF-----------------------------------HVEDLEGGI
                                                                        

P10415_BCL2-03        -------LVGACITLGAYLGHK
P10415_BCL2-09        -------LVGACITLGAYLGHK
Q07820_MCL1-05        RNVLLAFAGVAGVGAGLAYLIR
Q16548_BCL2A1-01      --MLVESVAHKKRKMAL-----
Q16548_BCL2A1-03      --IVLSCEIEIENFLAS-----
Q16548_BCL2A1-02      WMTFLEVTGKICEMLSLLKQYC
Q07817_BCL2L1-02      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-14      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-12      FWLHH-----------------
Q07817_BCL2L1-15      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-05      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-01      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-03      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-04      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-06      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-07      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-08      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-09      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-10      RWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-11      RWFLTGMTVAGVVLLGSLFSRK
P10415_BCL2-08        MMSSRFIHVLACVTASFILKAE
P10415_BCL2-06        LLSLALVG--ACITLGAYLGHK
P10415_BCL2-07        LLSLALVG--ACITLGAYLGHK
A9QXG9_BCL2-01        LLSLALVG--ACITLGAYLSHK
P10415_BCL2-10        ----------------------
P10415_BCL2-04        ----------------------
P10415_BCL2-05        ----------------------
B4DLY8_MCL1-01        RNVLLAFAGVAGVGAGLAYLIR
B4DG83_MCL1-01        RNVLLAFAGVAGVGAGLAYLIR
B4E3L8_MCL1-01        RNVLLAFAGVAGVGAGLAYLIR
Q07820_MCL1-09        -----------GISNKIALL--
Q07820_MCL1-03        RNVLLAFAGVAGVGAGLAYLIR
Q07820_MCL1-07        RNVLLAFAGVAGVGAGLAYLIR
B4DU51_MCL1-01        RNVLLAFAGVAGVGAGLAYLIR
C8YZ26_MCL1-01        RNVLLAFAGVAGVGAGLAYLKR
Q07820_MCL1-06        RNVLLAFAGVAGVGAGLAYLIR
                                            

© 1998-2022Legal notice