Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

51 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P10415_BCL2-09          -------MEDA----------------F----------------------
P10415_BCL2-03          -MNPRVPGQDA----------------F----------------------
Q92843_BCL2L2-09        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-01        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSK----------------
Q16548_BCL2A1-03        --MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSK----------------
Q16548_BCL2A1-01        --MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSK----------------
P10415_BCL2-08          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-06          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-07          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
A9QXG9_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-05          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-04          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-10          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
Q9HD36_BCL2L10-01       MVDQLRERTTMADPLRERTELLLADY-----LGYCAR-------------
Q9HD36_BCL2L10-02       MVDQLRERTTMADPLRERTELLLADY-----LGYCAR-------------
A0A7I2V383_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
A0A7I2V383_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
A0A7I2V383_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
B4DLY8_MCL1-01          ---------MFGLKRNAVIGLNLYCGGAG---------------------
B4DG83_MCL1-01          ----------------------------M---------------------
B4E3L8_MCL1-01          ----------------------------M---------------------
Q07820_MCL1-09          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
Q07820_MCL1-07          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
Q07820_MCL1-03          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
B4DU51_MCL1-01          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEM-
C8YZ26_MCL1-01          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL-----
Q07820_MCL1-06          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL-----
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-04        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-08        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-02        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-03        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-05        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-06        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q07817_BCL2L1-02        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-14        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-15        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-12        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-07        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-06        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-05        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-04        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-03        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-11        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-10        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-09        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-08        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
P10415_BCL2-08          --------------------------------------------------
P10415_BCL2-06          --------------------------------------------------
P10415_BCL2-07          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
P10415_BCL2-10          --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
Q07820_MCL1-09          ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
Q07820_MCL1-07          ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
Q07820_MCL1-03          ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
B4DU51_MCL1-01          --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
Q07820_MCL1-06          --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
Q07817_BCL2L1-14        --------------------------------------------------
Q07817_BCL2L1-15        --------------------------------------------------
Q07817_BCL2L1-12        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-07        --------------------------------------------------
Q07817_BCL2L1-06        --------------------------------------------------
Q07817_BCL2L1-05        --------------------------------------------------
Q07817_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
Q07817_BCL2L1-11        --------------------------------------------------
Q07817_BCL2L1-10        --------------------------------------------------
Q07817_BCL2L1-09        --------------------------------------------------
Q07817_BCL2L1-08        --------------------------------------------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
P10415_BCL2-08          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-06          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-07          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
A9QXG9_BCL2-01          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-05          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-04          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-10          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
Q9HD36_BCL2L10-01       --------------------EPGTPEPAPS--------TPEAAVLRSAAA
Q9HD36_BCL2L10-02       --------------------EPGTPEPAPS--------TPEAAVLRSAAA
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
B4DLY8_MCL1-01          --------------------LGAGSGGATRPGGRLLATEKEASARRE---
B4DG83_MCL1-01          --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
B4E3L8_MCL1-01          --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-09          TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-07          TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-03          TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
B4DU51_MCL1-01          --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
C8YZ26_MCL1-01          --------------------------------------------------
Q07820_MCL1-06          --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
Q07817_BCL2L1-02        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-14        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-15        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-12        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-01        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-07        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-06        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-05        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-04        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-03        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-11        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-10        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-09        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-08        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
                                                                          

P10415_BCL2-09          -----VELYGPSMRPLFDF-------------------------------
P10415_BCL2-03          -----VELYGPSMRPLFDF-------------------------------
Q92843_BCL2L2-09        -----VCGAGPGEGPAADP-------------------------------
Q92843_BCL2L2-01        -----VCGAGPGEGPAADP-------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
P10415_BCL2-08          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-06          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-07          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
A9QXG9_BCL2-01          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-05          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-04          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-10          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
Q9HD36_BCL2L10-01       R-------------------------------------------------
Q9HD36_BCL2L10-02       R-------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
B4DLY8_MCL1-01          -----IGGGEAGAVIGGSAGASPPSTLTPDSR-------------RVARP
B4DG83_MCL1-01          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4E3L8_MCL1-01          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-09          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-07          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-03          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4DU51_MCL1-01          PLLELVGESGNNTSTDGSLPLTPPPAEEEEDELYRQSLEIISRYLREQAT
C8YZ26_MCL1-01          ------------------------------------------------AT
Q07820_MCL1-06          ------------------------------------------------AT
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-04        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-08        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-02        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-03        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-05        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-06        -----VCGAGPGEGPAAD--------P-----------------------
Q07817_BCL2L1-02        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-14        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-15        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-12        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-01        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-07        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-06        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-05        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-04        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-03        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-11        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-10        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-09        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-08        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
                                                                          

P10415_BCL2-09          -----------------SWLSLKTL---LSLALVGACITLGAYLGHK---
P10415_BCL2-03          -----------------SWLSLKTL---LSLALVGACITLGAYLGHK---
Q92843_BCL2L2-09        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVT---
Q92843_BCL2L2-01        -----------------LHQAMRAAGD-----------------------
Q07820_MCL1-05          -------MGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
Q16548_BCL2A1-02        -----------------TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q16548_BCL2A1-03        -----------------TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q16548_BCL2A1-01        -----------------TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
P10415_BCL2-08          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-06          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-07          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
A9QXG9_BCL2-01          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-05          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-04          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-10          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
Q9HD36_BCL2L10-01       ---------------------LRQIHRSFFSAY---LGYPGNRFELVA-L
Q9HD36_BCL2L10-02       ---------------------LRQIHRSFFSAY---LGYPGNRFELVA-L
A0A7I2V383_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
A0A7I2V383_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
A0A7I2V383_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
B4DLY8_MCL1-01          PPKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
B4DG83_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
B4E3L8_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
Q07820_MCL1-09          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV------
Q07820_MCL1-07          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
Q07820_MCL1-03          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
B4DU51_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
C8YZ26_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRRLDIKN-E
Q07820_MCL1-06          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
Q92843_BCL2L2-10        ---------------------------------XRTFSDLAAQLHVTP-G
Q92843_BCL2L2-07        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-04        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-08        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-02        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-03        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-05        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-06        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q07817_BCL2L1-02        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-14        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-15        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-12        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-01        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-07        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-06        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-05        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-04        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-03        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-11        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-10        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-09        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-08        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
Q16548_BCL2A1-02        TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI---------------
Q16548_BCL2A1-03        TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI---------------
Q16548_BCL2A1-01        TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI---------------
P10415_BCL2-08          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-06          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-07          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
A9QXG9_BCL2-01          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-05          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-04          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-10          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
Q9HD36_BCL2L10-01       MADSVLSD------SPG-PTWGRVVTLVTFAGTLLERGPLVTARWKKWGF
Q9HD36_BCL2L10-02       MADSVLSD------SPG-PTWGRVVTLVTFAGTLLERGPLVTARWKKWGF
A0A7I2V383_BCL2L2-      SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
A0A7I2V383_BCL2L2-      SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
A0A7I2V383_BCL2L2-      SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
B4DLY8_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
B4DG83_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
B4E3L8_MCL1-01          DDVKSLSRVMIHVFSDSVTNWGRIVTLISFGAFVA---------------
Q07820_MCL1-09          ------------LPCRGPRRW-----------------------------
Q07820_MCL1-07          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
Q07820_MCL1-03          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
B4DU51_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
C8YZ26_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
Q07820_MCL1-06          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
Q92843_BCL2L2-10        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-07        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-04        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-08        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-02        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-03        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-05        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-06        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q07817_BCL2L1-02        TAYQSFEQ------------------------------------------
Q07817_BCL2L1-14        TAYQSFEQ------------------------------------------
Q07817_BCL2L1-15        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-12        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-01        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-07        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-06        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-05        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-04        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-03        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-11        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-10        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-09        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-08        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q16548_BCL2A1-02        ---KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW-------
Q16548_BCL2A1-03        ---KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW-------
Q16548_BCL2A1-01        ---KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW-------
P10415_BCL2-08          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-06          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-07          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
A9QXG9_BCL2-01          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-05          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-04          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-10          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
Q9HD36_BCL2L10-01       QPRLKEQEGDVARDCQ---RLVALLSSRLMGQHRAWLQAQGGW-------
Q9HD36_BCL2L10-02       QPRLKEQEGDVARDCQ---RLVALLSSRLMGQHRAWLQAQGGW-------
A0A7I2V383_BCL2L2-      ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
A0A7I2V383_BCL2L2-      ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
A0A7I2V383_BCL2L2-      ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGWLSQITEA
B4DLY8_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
B4DG83_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
B4E3L8_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q07820_MCL1-09          ----------HQECAA---GFCRCCWS------RSWF-------------
Q07820_MCL1-07          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q07820_MCL1-03          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
B4DU51_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
C8YZ26_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q07820_MCL1-06          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q92843_BCL2L2-10        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-07        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-04        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-08        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-02        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-03        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-05        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-06        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q07817_BCL2L1-02        --------------------------------------------------
Q07817_BCL2L1-14        --------------------------------------------------
Q07817_BCL2L1-15        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWLDWWCFC
Q07817_BCL2L1-12        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-01        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-07        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-06        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-05        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-04        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-03        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-11        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-10        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-09        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-08        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
P10415_BCL2-08          --------------------------------------------------
P10415_BCL2-06          --------------------------------------------------
P10415_BCL2-07          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
P10415_BCL2-10          --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
A0A7I2V383_BCL2L2-      -------------------------ELEAIKARVREMEEEAEKLKELQNE
A0A7I2V383_BCL2L2-      -------------------------ELEAIKARVREMEEEAEKLKELQNE
A0A7I2V383_BCL2L2-      EMADEVICSEILSDCDSAASSPDLEELEAIKARVREMEEEAEKLKELQNE
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
Q07820_MCL1-09          --------------------------------------------------
Q07820_MCL1-07          --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
Q07820_MCL1-06          --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
Q07817_BCL2L1-14        --------------------------------------------------
Q07817_BCL2L1-15        SAHLRVIITDGGDWGGPILPLGSAGSPDLHLNPTPVWCLRIEAATLWDLS
Q07817_BCL2L1-12        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-07        --------------------------------------------------
Q07817_BCL2L1-06        --------------------------------------------------
Q07817_BCL2L1-05        --------------------------------------------------
Q07817_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
Q07817_BCL2L1-11        --------------------------------------------------
Q07817_BCL2L1-10        --------------------------------------------------
Q07817_BCL2L1-09        --------------------------------------------------
Q07817_BCL2L1-08        --------------------------------------------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          ----------------------------------------DGFVEFFHVE
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
P10415_BCL2-08          -------------TE-----------------------TQDLFNSNACSP
P10415_BCL2-06          -------------DA-----------------------FVELY-------
P10415_BCL2-07          -------------DA-----------------------FVELY-------
A9QXG9_BCL2-01          -------------DA-----------------------FVELY-------
P10415_BCL2-05          -------------LY-----------------------M-----------
P10415_BCL2-04          -------------VG-----------------------ALGDV-------
P10415_BCL2-10          -------------VG-----------------------ALGDV-------
Q9HD36_BCL2L10-01       -------------DG-----------------------FCHFF-------
Q9HD36_BCL2L10-02       -------------VSTRRTPGHGAGRAAGKRPRGWHGWLLSLL-------
A0A7I2V383_BCL2L2-      VEKQMNMSPPPGNAG-----------------------PVIMS-------
A0A7I2V383_BCL2L2-      VEKQMNMSPPPGNAG-----------------------PVIMS-------
A0A7I2V383_BCL2L2-      VEKQMNMSPPPGNAG-----------------------PVIMS-------
B4DLY8_MCL1-01          -------------DG-----------------------FVEFF-------
B4DG83_MCL1-01          -------------DG-----------------------FVEFF-------
B4E3L8_MCL1-01          -------------DG-----------------------FVEFF-------
Q07820_MCL1-09          --------------------------------------------------
Q07820_MCL1-07          -------------DG-----------------------FVEFF-------
Q07820_MCL1-03          -------------DG-----------------------FVEFF-------
B4DU51_MCL1-01          -------------DG-----------------------FVEFF-------
C8YZ26_MCL1-01          -------------DG-----------------------FVEFF-------
Q07820_MCL1-06          -------------DG-----------------------FVEFF-------
Q92843_BCL2L2-10        ----------------------------------------AEFTALYGDG
Q92843_BCL2L2-07        ----------------------------------------VRSFSIAALH
Q92843_BCL2L2-04        ----------------------------------------V---------
Q92843_BCL2L2-08        ----------------------------------------AEFTALYGDG
Q92843_BCL2L2-02        ----------------------------------------AEFTALYGDG
Q92843_BCL2L2-03        ----------------------------------------AEFTALYGDG
Q92843_BCL2L2-05        ----------------------------------------AEFTALYGDG
Q92843_BCL2L2-06        ----------------------------------------AEFTALYGDG
Q07817_BCL2L1-02        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-14        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-15        CFHFCSQLSGLCGPH-----------------------LQDTFVELYGNN
Q07817_BCL2L1-12        ----------------------------------------VP--------
Q07817_BCL2L1-01        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-07        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-06        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-05        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-04        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-03        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-11        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-10        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-09        ----------------------------------------DTFVELYGNN
Q07817_BCL2L1-08        ----------------------------------------DTFVELYGNN
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          DLE-------------------------------GGIRNVLLAFAGVAGV
Q16548_BCL2A1-02        ------------------------ENGFVKKFEPKSGWMTFLEVTGKICE
Q16548_BCL2A1-03        ------------------------VCVMEKFF-------IVLSCEIEIEN
Q16548_BCL2A1-01        ------------------------GKWHNHTP-------MLVESVAHKKR
P10415_BCL2-08          TPAALATTILLPASMNLTTLGTSHKWTHTCDWLVTLSMMSSRFIHVLACV
P10415_BCL2-06          --------------------GPSMRPLFDFSWLSLKTLLSLALVG--ACI
P10415_BCL2-07          --------------------GPSMRPLFDFSWLSLKTLLSLALVG--ACI
A9QXG9_BCL2-01          --------------------GPSMRPLFDFSWLSLKTLLSLALVG--ACI
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-04          --------------------SLG---------------------------
P10415_BCL2-10          --------------------SLG---------------------------
Q9HD36_BCL2L10-01       -----------RTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL-----
Q9HD36_BCL2L10-02       -----------QDPLSTGFLEKTAGPGFSVMLVNNSLHLSLDTIIMSFKT
A0A7I2V383_BCL2L2-      -IEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGH
A0A7I2V383_BCL2L2-      -IEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGH
A0A7I2V383_BCL2L2-      -IEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGH
B4DLY8_MCL1-01          -HVEDLE---------------------------GGIRNVLLAFAGVAGV
B4DG83_MCL1-01          -HVEDLE---------------------------GGIRNVLLAFAGVAGV
B4E3L8_MCL1-01          -HVEDLE---------------------------GGIRNVLLAFAGVAGV
Q07820_MCL1-09          ------------------------------------------------GI
Q07820_MCL1-07          -HVEDLE---------------------------GGIRNVLLAFAGVAGV
Q07820_MCL1-03          -HVEDLE---------------------------GGIRNVLLAFAGVAGV
B4DU51_MCL1-01          -HVEDLE---------------------------GGIRNVLLAFAGVAGV
C8YZ26_MCL1-01          -QVEDLE---------------------------GGIRNVLLAFAGVAGV
Q07820_MCL1-06          -HVEDLE---------------------------GGIRNVLLAFAGVAGV
Q92843_BCL2L2-10        ALEEARRLRE--GNWASVRTVLTGAVALGALVWSTLFTLPSTTGHISLLA
Q92843_BCL2L2-07        ILLQSWS-PG--GRWGL---------------------------------
Q92843_BCL2L2-04        --------------WSTLFTLPSTTGHISLLA------------------
Q92843_BCL2L2-08        ALEEARRLRE--GNWASVRTVLTGAVALGALV------------------
Q92843_BCL2L2-02        ALEEARRLRE--GNWASVRTVLTGAVALGALV------------------
Q92843_BCL2L2-03        ALEEARRLRE--GNWASVRTVLTGAVALGALV------------------
Q92843_BCL2L2-05        ALEEARRLRE--GNWASVRTVLTGAVALGALV------------------
Q92843_BCL2L2-06        ALEEARRLRE--GNWASVRTVLTGAVALGALV------------------
Q07817_BCL2L1-02        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-14        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-15        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-12        --------DASFRFW------LHH--------------------------
Q07817_BCL2L1-01        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-07        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-06        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-05        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-04        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-03        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-11        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-10        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-09        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
Q07817_BCL2L1-08        AAAESRKGQERFNRW------FLTGMTVAGVV------------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q07820_MCL1-05          GAGLAYLIR-----------------------------------------
Q16548_BCL2A1-02        MLSLLKQYC-----------------------------------------
Q16548_BCL2A1-03        FLAS----------------------------------------------
Q16548_BCL2A1-01        KMAL----------------------------------------------
P10415_BCL2-08          TASFILKAE-----------------------------------------
P10415_BCL2-06          TLGAYLGHK-----------------------------------------
P10415_BCL2-07          TLGAYLGHK-----------------------------------------
A9QXG9_BCL2-01          TLGAYLSHK-----------------------------------------
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
P10415_BCL2-10          --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-02       FNPLLPAQL-----------------------------------------
A0A7I2V383_BCL2L2-      PKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGF
A0A7I2V383_BCL2L2-      PKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGF
A0A7I2V383_BCL2L2-      PKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGF
B4DLY8_MCL1-01          GAGLAYLIR-----------------------------------------
B4DG83_MCL1-01          GAGLAYLIR-----------------------------------------
B4E3L8_MCL1-01          GAGLAYLIR-----------------------------------------
Q07820_MCL1-09          SNKIALL-------------------------------------------
Q07820_MCL1-07          GAGLAYLIR-----------------------------------------
Q07820_MCL1-03          GAGLAYLIR-----------------------------------------
B4DU51_MCL1-01          GAGLAYLIR-----------------------------------------
C8YZ26_MCL1-01          GAGLAYLKR-----------------------------------------
Q07820_MCL1-06          GAGLAYLIR-----------------------------------------
Q92843_BCL2L2-10        FPGTFSQEELQGPWPGYQNALL----------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        FPGTFSQEELQGPWPGYQNALL----------------------------
Q92843_BCL2L2-08        TVGAFFASK-----------------------------------------
Q92843_BCL2L2-02        TVGAFFASK-----------------------------------------
Q92843_BCL2L2-03        TVGAFFASK-----------------------------------------
Q92843_BCL2L2-05        TVGAFFASK-----------------------------------------
Q92843_BCL2L2-06        TVGAFFASK-----------------------------------------
Q07817_BCL2L1-02        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-14        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-15        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-12        --------------------------------------------------
Q07817_BCL2L1-01        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-07        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-06        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-05        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-04        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-03        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-11        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-10        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-09        LLGSLFSRK-----------------------------------------
Q07817_BCL2L1-08        LLGSLFSRK-----------------------------------------
                                                                          

P10415_BCL2-09          ---------------------------------------------
P10415_BCL2-03          ---------------------------------------------
Q92843_BCL2L2-09        ---------------------------------------------
Q92843_BCL2L2-01        ---------------------------------------------
Q07820_MCL1-05          ---------------------------------------------
Q16548_BCL2A1-02        ---------------------------------------------
Q16548_BCL2A1-03        ---------------------------------------------
Q16548_BCL2A1-01        ---------------------------------------------
P10415_BCL2-08          ---------------------------------------------
P10415_BCL2-06          ---------------------------------------------
P10415_BCL2-07          ---------------------------------------------
A9QXG9_BCL2-01          ---------------------------------------------
P10415_BCL2-05          ---------------------------------------------
P10415_BCL2-04          ---------------------------------------------
P10415_BCL2-10          ---------------------------------------------
Q9HD36_BCL2L10-01       ---------------------------------------------
Q9HD36_BCL2L10-02       ---------------------------------------------
A0A7I2V383_BCL2L2-      PRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A7I2V383_BCL2L2-      PRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
A0A7I2V383_BCL2L2-      PRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
B4DLY8_MCL1-01          ---------------------------------------------
B4DG83_MCL1-01          ---------------------------------------------
B4E3L8_MCL1-01          ---------------------------------------------
Q07820_MCL1-09          ---------------------------------------------
Q07820_MCL1-07          ---------------------------------------------
Q07820_MCL1-03          ---------------------------------------------
B4DU51_MCL1-01          ---------------------------------------------
C8YZ26_MCL1-01          ---------------------------------------------
Q07820_MCL1-06          ---------------------------------------------
Q92843_BCL2L2-10        ---------------------------------------------
Q92843_BCL2L2-07        ---------------------------------------------
Q92843_BCL2L2-04        ---------------------------------------------
Q92843_BCL2L2-08        ---------------------------------------------
Q92843_BCL2L2-02        ---------------------------------------------
Q92843_BCL2L2-03        ---------------------------------------------
Q92843_BCL2L2-05        ---------------------------------------------
Q92843_BCL2L2-06        ---------------------------------------------
Q07817_BCL2L1-02        ---------------------------------------------
Q07817_BCL2L1-14        ---------------------------------------------
Q07817_BCL2L1-15        ---------------------------------------------
Q07817_BCL2L1-12        ---------------------------------------------
Q07817_BCL2L1-01        ---------------------------------------------
Q07817_BCL2L1-07        ---------------------------------------------
Q07817_BCL2L1-06        ---------------------------------------------
Q07817_BCL2L1-05        ---------------------------------------------
Q07817_BCL2L1-04        ---------------------------------------------
Q07817_BCL2L1-03        ---------------------------------------------
Q07817_BCL2L1-11        ---------------------------------------------
Q07817_BCL2L1-10        ---------------------------------------------
Q07817_BCL2L1-09        ---------------------------------------------
Q07817_BCL2L1-08        ---------------------------------------------
                                                                     

© 1998-2022Legal notice