Dataset for protein BCL-2-like of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

51 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P10415_BCL2-09          -------MEDA----------------F----------------------
P10415_BCL2-03          -MNPRVPGQDA----------------F----------------------
Q92843_BCL2L2-01        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-09        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSK----------------
Q16548_BCL2A1-01        --MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSK----------------
Q16548_BCL2A1-03        --MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSK----------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-04        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-02        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-03        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-05        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-06        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q92843_BCL2L2-08        -MATPASAPDTRALVADFVGYKLRQKGY----------------------
Q07817_BCL2L1-02        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-14        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-15        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-11        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-04        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-10        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-05        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-06        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-09        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-08        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-07        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-03        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q07817_BCL2L1-12        ------MSQSNRELVVDFLSYKLSQKGYSWSQFS----------------
Q9HD36_BCL2L10-01       MVDQLRERTTMADPLRERTELLLADY-----LGYCAR-------------
Q9HD36_BCL2L10-02       MVDQLRERTTMADPLRERTELLLADY-----LGYCAR-------------
P10415_BCL2-05          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-10          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-04          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-07          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-06          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
A9QXG9_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
P10415_BCL2-08          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGA-------------
A0A7I2V383_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
A0A7I2V383_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
A0A7I2V383_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAGPG---------------
Q07820_MCL1-09          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
Q07820_MCL1-03          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
Q07820_MCL1-07          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKE
B4DLY8_MCL1-01          ---------MFGLKRNAVIGLNLYCGGAG---------------------
B4DG83_MCL1-01          ----------------------------M---------------------
B4E3L8_MCL1-01          ----------------------------M---------------------
B4DU51_MCL1-01          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEM-
C8YZ26_MCL1-01          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL-----
Q07820_MCL1-06          ---------MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLL-----
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
Q07817_BCL2L1-14        --------------------------------------------------
Q07817_BCL2L1-15        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-11        --------------------------------------------------
Q07817_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-10        --------------------------------------------------
Q07817_BCL2L1-05        --------------------------------------------------
Q07817_BCL2L1-06        --------------------------------------------------
Q07817_BCL2L1-09        --------------------------------------------------
Q07817_BCL2L1-08        --------------------------------------------------
Q07817_BCL2L1-07        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
Q07817_BCL2L1-12        --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-10          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
P10415_BCL2-07          --------------------------------------------------
P10415_BCL2-06          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
P10415_BCL2-08          --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
Q07820_MCL1-09          ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
Q07820_MCL1-03          ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
Q07820_MCL1-07          ASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTA
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
Q07820_MCL1-06          --------------------------------------------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q07817_BCL2L1-02        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-14        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-15        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-01        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-11        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-04        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-10        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-05        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-06        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-09        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-08        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-07        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-03        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q07817_BCL2L1-12        --------------------DVEENRTEAPEGTESEMETPSAINGNPSWH
Q9HD36_BCL2L10-01       --------------------EPGTPEPAPS--------TPEAAVLRSAAA
Q9HD36_BCL2L10-02       --------------------EPGTPEPAPS--------TPEAAVLRSAAA
P10415_BCL2-05          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-10          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-04          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-07          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-06          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
A9QXG9_BCL2-01          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
P10415_BCL2-08          --------------------APPGAAPAPGIFSSQPGHTPHPAASRDPVA
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
Q07820_MCL1-09          TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-03          TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
Q07820_MCL1-07          TPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVL
B4DLY8_MCL1-01          --------------------LGAGSGGATRPGGRLLATEKEASARRE---
B4DG83_MCL1-01          --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
B4E3L8_MCL1-01          --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
B4DU51_MCL1-01          --------------------EAPAADAIMSPEEELDGYEPEPLGKRPAVL
C8YZ26_MCL1-01          --------------------------------------------------
Q07820_MCL1-06          --------------------------------------------------
                                                                          

P10415_BCL2-09          -----VELYGPSMRPLFDF-------------------------------
P10415_BCL2-03          -----VELYGPSMRPLFDF-------------------------------
Q92843_BCL2L2-01        -----VCGAGPGEGPAADP-------------------------------
Q92843_BCL2L2-09        -----VCGAGPGEGPAADP-------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-04        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-02        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-03        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-05        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-06        -----VCGAGPGEGPAAD--------P-----------------------
Q92843_BCL2L2-08        -----VCGAGPGEGPAAD--------P-----------------------
Q07817_BCL2L1-02        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-14        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-15        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-01        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-11        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-04        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-10        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-05        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-06        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-09        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-08        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-07        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-03        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q07817_BCL2L1-12        LADSPAVNGATGHSSSLDAREVIPMAA-----------------------
Q9HD36_BCL2L10-01       R-------------------------------------------------
Q9HD36_BCL2L10-02       R-------------------------------------------------
P10415_BCL2-05          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-10          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-04          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-07          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-06          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
A9QXG9_BCL2-01          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
P10415_BCL2-08          RTSPLQTPAAPGAAAGPALSPVPPV-------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
A0A7I2V383_BCL2L2-      --------------------------------------------------
Q07820_MCL1-09          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-03          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
Q07820_MCL1-07          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4DLY8_MCL1-01          -----IGGGEAGAVIGGSAGASPPSTLTPDSR-------------RVARP
B4DG83_MCL1-01          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4E3L8_MCL1-01          PLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQAT
B4DU51_MCL1-01          PLLELVGESGNNTSTDGSLPLTPPPAEEEEDELYRQSLEIISRYLREQAT
C8YZ26_MCL1-01          ------------------------------------------------AT
Q07820_MCL1-06          ------------------------------------------------AT
                                                                          

P10415_BCL2-09          -----------------SWLSLKTL---LSLALVGACITLGAYLGHK---
P10415_BCL2-03          -----------------SWLSLKTL---LSLALVGACITLGAYLGHK---
Q92843_BCL2L2-01        -----------------LHQAMRAAGD-----------------------
Q92843_BCL2L2-09        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVT---
Q07820_MCL1-05          -------MGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
Q16548_BCL2A1-02        -----------------TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q16548_BCL2A1-01        -----------------TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q16548_BCL2A1-03        -----------------TSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVD
Q92843_BCL2L2-10        ---------------------------------XRTFSDLAAQLHVTP-G
Q92843_BCL2L2-07        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-04        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-02        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-03        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-05        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-06        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q92843_BCL2L2-08        -----------------LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q07817_BCL2L1-02        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-14        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-15        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-01        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-11        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-04        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-10        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-05        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-06        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-09        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-08        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-07        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-03        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q07817_BCL2L1-12        -----------------VKQALREAGDEFELRYRRAFSDLTSQLHITP-G
Q9HD36_BCL2L10-01       ---------------------LRQIHRSFFSAY---LGYPGNRFELVA-L
Q9HD36_BCL2L10-02       ---------------------LRQIHRSFFSAY---LGYPGNRFELVA-L
P10415_BCL2-05          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-10          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-04          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-07          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-06          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
A9QXG9_BCL2-01          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
P10415_BCL2-08          -----------------VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-F
A0A7I2V383_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
A0A7I2V383_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
A0A7I2V383_BCL2L2-      ----------EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-G
Q07820_MCL1-09          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGWVCGV------
Q07820_MCL1-03          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
Q07820_MCL1-07          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
B4DLY8_MCL1-01          PPKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
B4DG83_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
B4E3L8_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
B4DU51_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
C8YZ26_MCL1-01          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRRLDIKN-E
Q07820_MCL1-06          GAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-E
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
Q16548_BCL2A1-02        TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI---------------
Q16548_BCL2A1-01        TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI---------------
Q16548_BCL2A1-03        TARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILI---------------
Q92843_BCL2L2-10        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-07        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-04        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-02        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-03        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-05        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-06        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q92843_BCL2L2-08        SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q07817_BCL2L1-02        TAYQSFEQ------------------------------------------
Q07817_BCL2L1-14        TAYQSFEQ------------------------------------------
Q07817_BCL2L1-15        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-01        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-11        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-04        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-10        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-05        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-06        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-09        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-08        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-07        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-03        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q07817_BCL2L1-12        TAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALC---------------
Q9HD36_BCL2L10-01       MADSVLSD------SPG-PTWGRVVTLVTFAGTLLERGPLVTARWKKWGF
Q9HD36_BCL2L10-02       MADSVLSD------SPG-PTWGRVVTLVTFAGTLLERGPLVTARWKKWGF
P10415_BCL2-05          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-10          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-04          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-07          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-06          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
A9QXG9_BCL2-01          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
P10415_BCL2-08          TARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMC---------------
A0A7I2V383_BCL2L2-      SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
A0A7I2V383_BCL2L2-      SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
A0A7I2V383_BCL2L2-      SAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALC---------------
Q07820_MCL1-09          ------------LPCRGPRRW-----------------------------
Q07820_MCL1-03          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
Q07820_MCL1-07          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
B4DLY8_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
B4DG83_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
B4E3L8_MCL1-01          DDVKSLSRVMIHVFSDSVTNWGRIVTLISFGAFVA---------------
B4DU51_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
C8YZ26_MCL1-01          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
Q07820_MCL1-06          DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVA---------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q16548_BCL2A1-02        ---KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW-------
Q16548_BCL2A1-01        ---KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW-------
Q16548_BCL2A1-03        ---KKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW-------
Q92843_BCL2L2-10        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-07        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-04        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-02        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-03        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-05        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-06        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q92843_BCL2L2-08        ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q07817_BCL2L1-02        --------------------------------------------------
Q07817_BCL2L1-14        --------------------------------------------------
Q07817_BCL2L1-15        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGWLDWWCFC
Q07817_BCL2L1-01        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-11        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-04        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-10        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-05        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-06        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-09        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-08        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-07        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-03        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q07817_BCL2L1-12        ---VESVDKEMQVLVS---RIAAWMATYLNDHLEPWIQENGGW-------
Q9HD36_BCL2L10-01       QPRLKEQEGDVARDCQ---RLVALLSSRLMGQHRAWLQAQGGW-------
Q9HD36_BCL2L10-02       QPRLKEQEGDVARDCQ---RLVALLSSRLMGQHRAWLQAQGGW-------
P10415_BCL2-05          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-10          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-04          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-07          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-06          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
A9QXG9_BCL2-01          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
P10415_BCL2-08          ---VESVNREMSPLVD---NIALWMTEYLNRHLHTWIQDNGGW-------
A0A7I2V383_BCL2L2-      ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGWLSQITEA
A0A7I2V383_BCL2L2-      ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
A0A7I2V383_BCL2L2-      ---AESVNKEMEPLVG---QVQEWMVAYLETQLADWIHSSGGW-------
Q07820_MCL1-09          ----------HQECAA---GFCRCCWS------RSWF-------------
Q07820_MCL1-03          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q07820_MCL1-07          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
B4DLY8_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
B4DG83_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
B4E3L8_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
B4DU51_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
C8YZ26_MCL1-01          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
Q07820_MCL1-06          ---KHLKTINQESCIE---PLAESITDVLVRTKRDWLVKQRGW-------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q92843_BCL2L2-10        --------------------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
Q07817_BCL2L1-14        --------------------------------------------------
Q07817_BCL2L1-15        SAHLRVIITDGGDWGGPILPLGSAGSPDLHLNPTPVWCLRIEAATLWDLS
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-11        --------------------------------------------------
Q07817_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-10        --------------------------------------------------
Q07817_BCL2L1-05        --------------------------------------------------
Q07817_BCL2L1-06        --------------------------------------------------
Q07817_BCL2L1-09        --------------------------------------------------
Q07817_BCL2L1-08        --------------------------------------------------
Q07817_BCL2L1-07        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
Q07817_BCL2L1-12        --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-10          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
P10415_BCL2-07          --------------------------------------------------
P10415_BCL2-06          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
P10415_BCL2-08          --------------------------------------------------
A0A7I2V383_BCL2L2-      EMADEVICSEILSDCDSAASSPDLEELEAIKARVREMEEEAEKLKELQNE
A0A7I2V383_BCL2L2-      -------------------------ELEAIKARVREMEEEAEKLKELQNE
A0A7I2V383_BCL2L2-      -------------------------ELEAIKARVREMEEEAEKLKELQNE
Q07820_MCL1-09          --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
Q07820_MCL1-07          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
Q07820_MCL1-06          --------------------------------------------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          -----------------DGFVEFFHVEDLE--------------------
Q16548_BCL2A1-02        ----------------------------------------------ENGF
Q16548_BCL2A1-01        ----------------------------------------------GKWH
Q16548_BCL2A1-03        ----------------------------------------------VCVM
Q92843_BCL2L2-10        -----------------AEFTALYGDGALEEARRLRE--GNW--------
Q92843_BCL2L2-07        -----------------VRSFSIAALHILLQSWS-PG--GRW--------
Q92843_BCL2L2-04        -----------------V-----------------------W--------
Q92843_BCL2L2-02        -----------------AEFTALYGDGALEEARRLRE--GNW--------
Q92843_BCL2L2-03        -----------------AEFTALYGDGALEEARRLRE--GNW--------
Q92843_BCL2L2-05        -----------------AEFTALYGDGALEEARRLRE--GNW--------
Q92843_BCL2L2-06        -----------------AEFTALYGDGALEEARRLRE--GNW--------
Q92843_BCL2L2-08        -----------------AEFTALYGDGALEEARRLRE--GNW--------
Q07817_BCL2L1-02        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-14        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-15        CFHFCSQLSGLCGPHLQDTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-01        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-11        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-04        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-10        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-05        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-06        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-09        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-08        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-07        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-03        -----------------DTFVELYGNNAAAESRKGQERFNRW--------
Q07817_BCL2L1-12        -----------------VP----------------DASFRFW--------
Q9HD36_BCL2L10-01       -----------------DG-----------------------FCHFFRTP
Q9HD36_BCL2L10-02       -----------------VSTRRTPGHGAGRAAGKRPRGWHGWLLSLLQDP
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-10          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
P10415_BCL2-07          -----------------DAFVELY--------------------------
P10415_BCL2-06          -----------------DAFVELY--------------------------
A9QXG9_BCL2-01          -----------------DAFVELY--------------------------
P10415_BCL2-08          -----------------TETQDLFNSNACSPTPAALA-----TTILLPAS
A0A7I2V383_BCL2L2-      VEKQMNMSPPPGN----AGPVIMSIEEKMEADARSIYVGNVDYGATAEEL
A0A7I2V383_BCL2L2-      VEKQMNMSPPPGN----AGPVIMSIEEKMEADARSIYVGNVDYGATAEEL
A0A7I2V383_BCL2L2-      VEKQMNMSPPPGN----AGPVIMSIEEKMEADARSIYVGNVDYGATAEEL
Q07820_MCL1-09          --------------------------------------------------
Q07820_MCL1-03          -----------------DGFVEFFHVEDLE--------------------
Q07820_MCL1-07          -----------------DGFVEFFHVEDLE--------------------
B4DLY8_MCL1-01          -----------------DGFVEFFHVEDLE--------------------
B4DG83_MCL1-01          -----------------DGFVEFFHVEDLE--------------------
B4E3L8_MCL1-01          -----------------DGFVEFFHVEDLE--------------------
B4DU51_MCL1-01          -----------------DGFVEFFHVEDLE--------------------
C8YZ26_MCL1-01          -----------------DGFVEFFQVEDLE--------------------
Q07820_MCL1-06          -----------------DGFVEFFHVEDLE--------------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
Q16548_BCL2A1-02        VKKFEPKSGWMTFLEVTGKICEMLSLLKQYC-------------------
Q16548_BCL2A1-01        NHTP-------MLVESVAHKKRKMAL------------------------
Q16548_BCL2A1-03        EKFF-------IVLSCEIEIENFLAS------------------------
Q92843_BCL2L2-10        -------ASVRTVLTGAVALGALVWSTLFTLPSTTGHISLLAFPGTFSQE
Q92843_BCL2L2-07        -------GL-----------------------------------------
Q92843_BCL2L2-04        -------STLFTLPSTTGHISLLAFPGTFSQEELQGPWPGYQNALL----
Q92843_BCL2L2-02        -------ASVRTVLTGAVALGALVTVGAFFASK-----------------
Q92843_BCL2L2-03        -------ASVRTVLTGAVALGALVTVGAFFASK-----------------
Q92843_BCL2L2-05        -------ASVRTVLTGAVALGALVTVGAFFASK-----------------
Q92843_BCL2L2-06        -------ASVRTVLTGAVALGALVTVGAFFASK-----------------
Q92843_BCL2L2-08        -------ASVRTVLTGAVALGALVTVGAFFASK-----------------
Q07817_BCL2L1-02        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-14        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-15        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-01        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-11        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-04        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-10        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-05        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-06        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-09        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-08        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-07        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-03        -------------FLTGMTVAGVVLLGSLFSRK-----------------
Q07817_BCL2L1-12        -------------LHH----------------------------------
Q9HD36_BCL2L10-01       FPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL-------------------
Q9HD36_BCL2L10-02       LSTGFLEKTAGPGFSVMLVNNSLHLSLDTIIMSFKTFNPLLPAQL-----
P10415_BCL2-05          -----------------------------LYM------------------
P10415_BCL2-10          -----------------------------VGALGDVSLG-----------
P10415_BCL2-04          -----------------------------VGALGDVSLG-----------
P10415_BCL2-07          ------GPSMRPLFDFSWLSLKTLLSLALVG--ACITLGAYLGHK-----
P10415_BCL2-06          ------GPSMRPLFDFSWLSLKTLLSLALVG--ACITLGAYLGHK-----
A9QXG9_BCL2-01          ------GPSMRPLFDFSWLSLKTLLSLALVG--ACITLGAYLSHK-----
P10415_BCL2-08          MNLTTLGTSHKWTHTCDWLVTLSMMSSRFIHVLACVTASFILKAE-----
A0A7I2V383_BCL2L2-      EAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
A0A7I2V383_BCL2L2-      EAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
A0A7I2V383_BCL2L2-      EAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFR
Q07820_MCL1-09          ---------------------GISNKIALL--------------------
Q07820_MCL1-03          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
Q07820_MCL1-07          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
B4DLY8_MCL1-01          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
B4DG83_MCL1-01          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
B4E3L8_MCL1-01          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
B4DU51_MCL1-01          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
C8YZ26_MCL1-01          -------GGIRNVLLAFAGVAGVGAGLAYLKR------------------
Q07820_MCL1-06          -------GGIRNVLLAFAGVAGVGAGLAYLIR------------------
                                                                          

P10415_BCL2-09          --------------------------------------------------
P10415_BCL2-03          --------------------------------------------------
Q92843_BCL2L2-01        --------------------------------------------------
Q92843_BCL2L2-09        --------------------------------------------------
Q07820_MCL1-05          --------------------------------------------------
Q16548_BCL2A1-02        --------------------------------------------------
Q16548_BCL2A1-01        --------------------------------------------------
Q16548_BCL2A1-03        --------------------------------------------------
Q92843_BCL2L2-10        ELQGPWPGYQNALL------------------------------------
Q92843_BCL2L2-07        --------------------------------------------------
Q92843_BCL2L2-04        --------------------------------------------------
Q92843_BCL2L2-02        --------------------------------------------------
Q92843_BCL2L2-03        --------------------------------------------------
Q92843_BCL2L2-05        --------------------------------------------------
Q92843_BCL2L2-06        --------------------------------------------------
Q92843_BCL2L2-08        --------------------------------------------------
Q07817_BCL2L1-02        --------------------------------------------------
Q07817_BCL2L1-14        --------------------------------------------------
Q07817_BCL2L1-15        --------------------------------------------------
Q07817_BCL2L1-01        --------------------------------------------------
Q07817_BCL2L1-11        --------------------------------------------------
Q07817_BCL2L1-04        --------------------------------------------------
Q07817_BCL2L1-10        --------------------------------------------------
Q07817_BCL2L1-05        --------------------------------------------------
Q07817_BCL2L1-06        --------------------------------------------------
Q07817_BCL2L1-09        --------------------------------------------------
Q07817_BCL2L1-08        --------------------------------------------------
Q07817_BCL2L1-07        --------------------------------------------------
Q07817_BCL2L1-03        --------------------------------------------------
Q07817_BCL2L1-12        --------------------------------------------------
Q9HD36_BCL2L10-01       --------------------------------------------------
Q9HD36_BCL2L10-02       --------------------------------------------------
P10415_BCL2-05          --------------------------------------------------
P10415_BCL2-10          --------------------------------------------------
P10415_BCL2-04          --------------------------------------------------
P10415_BCL2-07          --------------------------------------------------
P10415_BCL2-06          --------------------------------------------------
A9QXG9_BCL2-01          --------------------------------------------------
P10415_BCL2-08          --------------------------------------------------
A0A7I2V383_BCL2L2-      GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP
A0A7I2V383_BCL2L2-      GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP
A0A7I2V383_BCL2L2-      GRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP
Q07820_MCL1-09          --------------------------------------------------
Q07820_MCL1-03          --------------------------------------------------
Q07820_MCL1-07          --------------------------------------------------
B4DLY8_MCL1-01          --------------------------------------------------
B4DG83_MCL1-01          --------------------------------------------------
B4E3L8_MCL1-01          --------------------------------------------------
B4DU51_MCL1-01          --------------------------------------------------
C8YZ26_MCL1-01          --------------------------------------------------
Q07820_MCL1-06          --------------------------------------------------
                                                                          

P10415_BCL2-09          ------------------
P10415_BCL2-03          ------------------
Q92843_BCL2L2-01        ------------------
Q92843_BCL2L2-09        ------------------
Q07820_MCL1-05          ------------------
Q16548_BCL2A1-02        ------------------
Q16548_BCL2A1-01        ------------------
Q16548_BCL2A1-03        ------------------
Q92843_BCL2L2-10        ------------------
Q92843_BCL2L2-07        ------------------
Q92843_BCL2L2-04        ------------------
Q92843_BCL2L2-02        ------------------
Q92843_BCL2L2-03        ------------------
Q92843_BCL2L2-05        ------------------
Q92843_BCL2L2-06        ------------------
Q92843_BCL2L2-08        ------------------
Q07817_BCL2L1-02        ------------------
Q07817_BCL2L1-14        ------------------
Q07817_BCL2L1-15        ------------------
Q07817_BCL2L1-01        ------------------
Q07817_BCL2L1-11        ------------------
Q07817_BCL2L1-04        ------------------
Q07817_BCL2L1-10        ------------------
Q07817_BCL2L1-05        ------------------
Q07817_BCL2L1-06        ------------------
Q07817_BCL2L1-09        ------------------
Q07817_BCL2L1-08        ------------------
Q07817_BCL2L1-07        ------------------
Q07817_BCL2L1-03        ------------------
Q07817_BCL2L1-12        ------------------
Q9HD36_BCL2L10-01       ------------------
Q9HD36_BCL2L10-02       ------------------
P10415_BCL2-05          ------------------
P10415_BCL2-10          ------------------
P10415_BCL2-04          ------------------
P10415_BCL2-07          ------------------
P10415_BCL2-06          ------------------
A9QXG9_BCL2-01          ------------------
P10415_BCL2-08          ------------------
A0A7I2V383_BCL2L2-      RGRVYRGRARATSWYSPY
A0A7I2V383_BCL2L2-      RGRVYRGRARATSWYSPY
A0A7I2V383_BCL2L2-      RGRVYRGRARATSWYSPY
Q07820_MCL1-09          ------------------
Q07820_MCL1-03          ------------------
Q07820_MCL1-07          ------------------
B4DLY8_MCL1-01          ------------------
B4DG83_MCL1-01          ------------------
B4E3L8_MCL1-01          ------------------
B4DU51_MCL1-01          ------------------
C8YZ26_MCL1-01          ------------------
Q07820_MCL1-06          ------------------
                                          

© 1998-2022Legal notice