Dataset for protein Bcl-xL of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************************                                
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPsaingnpswhladspavngatghsssldarev
                                                --------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ipmaavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
--------------------------------------------------------------------------------

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
                                                                         
vlvsriaawmatylndhlepwiqenggw---------------------------------------------
----------------------------dtfvelygnnaaaesrkgqerfnrwfltgmtvagvvllgslfsrk
© 1998-2020Legal notice