Dataset for protein Bcl-xL of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

14 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q07817_BCL2L1-14      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-15      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-11      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-08      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-03      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-04      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-05      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-06      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-07      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-09      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-10      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-12      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
                      **************************************************

Q07817_BCL2L1-14      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-02      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-15      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-11      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-08      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-03      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-04      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-05      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-06      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-07      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-09      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-10      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-12      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

Q07817_BCL2L1-14      YRRAFSDLTSQLHITPGTAYQSFEQ-------------------------
Q07817_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQ-------------------------
Q07817_BCL2L1-15      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-11      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-08      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-03      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-04      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-05      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-06      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-07      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-09      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-10      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-12      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      *************************                         

Q07817_BCL2L1-14      --------------------------------------------------
Q07817_BCL2L1-02      --------------------------------------------------
Q07817_BCL2L1-15      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWLDWWCFCSAHLR
Q07817_BCL2L1-11      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-08      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-01      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-03      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-04      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-05      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-06      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-07      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-09      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-10      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-12      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
                                                                        

Q07817_BCL2L1-14      --------------------------------------------------
Q07817_BCL2L1-02      --------------------------------------------------
Q07817_BCL2L1-15      VIITDGGDWGGPILPLGSAGSPDLHLNPTPVWCLRIEAATLWDLSCFHFC
Q07817_BCL2L1-11      --------------------------------------------------
Q07817_BCL2L1-08      --------------------------------------------------
Q07817_BCL2L1-01      --------------------------------------------------
Q07817_BCL2L1-03      --------------------------------------------------
Q07817_BCL2L1-04      --------------------------------------------------
Q07817_BCL2L1-05      --------------------------------------------------
Q07817_BCL2L1-06      --------------------------------------------------
Q07817_BCL2L1-07      --------------------------------------------------
Q07817_BCL2L1-09      --------------------------------------------------
Q07817_BCL2L1-10      --------------------------------------------------
Q07817_BCL2L1-12      --------------------------------------------------
                                                                        

Q07817_BCL2L1-14      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-02      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-15      SQLSGLCGPHLQDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-11      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-08      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-01      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-03      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-04      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-05      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-06      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-07      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-09      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-10      ------------DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLL
Q07817_BCL2L1-12      ------------VP----------------DASFRFWLHH----------
                                   .                :  *. *:            

Q07817_BCL2L1-14      GSLFSRK
Q07817_BCL2L1-02      GSLFSRK
Q07817_BCL2L1-15      GSLFSRK
Q07817_BCL2L1-11      GSLFSRK
Q07817_BCL2L1-08      GSLFSRK
Q07817_BCL2L1-01      GSLFSRK
Q07817_BCL2L1-03      GSLFSRK
Q07817_BCL2L1-04      GSLFSRK
Q07817_BCL2L1-05      GSLFSRK
Q07817_BCL2L1-06      GSLFSRK
Q07817_BCL2L1-07      GSLFSRK
Q07817_BCL2L1-09      GSLFSRK
Q07817_BCL2L1-10      GSLFSRK
Q07817_BCL2L1-12      -------
                             

© 1998-2021Legal notice