Dataset for protein Bcl-xL of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q07817_BCL2L1-09      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETP--
Q07817_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-03      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-04      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-08      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-07      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-05      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q07817_BCL2L1-06      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
                      ************************************************  

Q07817_BCL2L1-09      --------------------------------------------------
Q07817_BCL2L1-02      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-03      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-04      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-08      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-07      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-05      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q07817_BCL2L1-06      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                                                                        

Q07817_BCL2L1-09      --------------------------------------------------
Q07817_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQ-------------------------
Q07817_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-03      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-04      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-08      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-07      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-05      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q07817_BCL2L1-06      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                                                                        

Q07817_BCL2L1-09      --------------------------------------------------
Q07817_BCL2L1-02      --------------------------------------DTFVELYGNNAA
Q07817_BCL2L1-01      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
Q07817_BCL2L1-03      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
Q07817_BCL2L1-04      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
Q07817_BCL2L1-08      CVESVDKEMQVLVSRIAAWMATYLNDHLEPW-------------------
Q07817_BCL2L1-07      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-05      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
Q07817_BCL2L1-06      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGW------------
                                                                        

Q07817_BCL2L1-09      ---------------------------------
Q07817_BCL2L1-02      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-01      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-03      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Q07817_BCL2L1-04      AESRK----------------------------
Q07817_BCL2L1-08      ---------------------------------
Q07817_BCL2L1-07      ---------------------------------
Q07817_BCL2L1-05      ---------------------------------
Q07817_BCL2L1-06      ---------------------------------
                                                       

© 1998-2020Legal notice