Dataset for protein BCL-2-like of organism Gouania willdenowi

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    . : . :                .  *.: * .   :: .              : . .               .:
mapvnrelvkfflch------------rlaQrdfPtsplrlqdtrdrtv-----vekekrspt--------------asn
-niqstkstslmntllatqnggvegrinyq knp rdhhaidtslhslngniassatpeapknlsvastfvpkalredge
 mt      v yi y            k s   y l  iv nepp   a sd ep ed  td               q  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  : .        .  . :. :      .* : : ::   :   :..* ..   .  .* .::: *:::*:        
glqdrsgvippr-hsdtdveavk-----laLvesadefelrftqafndLatqlqitpdtAyssfksVmdeVfk-------
dmengdlpctqevpgadeadvsncsggaev endtrqlmslyladytg skr-dwnesk lqtmer ved lekhryayn
 tl a p qq  l    sl            rdt n      sl   h h   a       n      r       
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            : .*****..*..**..:*    *.  *  *  : : :: **    . *: .
----------------------------dgvNWGRIvgLfvFGgvlClecsEkdmSelVpriadwmtmYLdenineWies
gmvnklsldncsddmtfvsavakslfadqrt     as va  aav qhlk rgr nc elvgqeist  lteqrp lvk
                                               v  v     ve   v   nh q   q 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: ..*     .:    .    . :         .   :                                          
e-ggWdsfaqifg-qdpeatvrnartsfkrwfligatvltgvr------k-r----------------------------
ngns ag-vdfmrvaiaaskahktlmamagfagfpmvlaflilflvcyv-r-lphlwvtyrtqrntkslsyqrqslprgs
q    rt -tv   h  viei sss-------vv gnivv wvvgslflqnekackrgrrlhllkgapdplfeifeld c
     er  el      h ae r ee   k l      s   mracgca k e                           

       330
....:....|
          
----------
nttstsspms
eikesriah 
          
© 1998-2022Legal notice