Dataset for protein BCL-2-like of organism Gouania willdenowi

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5H9Y5_MCL1-02      MNIVSTKSTSLMNCLLATQNGGVEGRINYQQKDPPRDHHAIDTSLDSLNG
A0A8C5H9Y5_MCL1-01      MNIVSTKSTSLMNCLLATQNGGVEGRINYQQKDPPRDHHAIDTSLDSLNG
A0A8C5G971_BCL2L1-      -MTQNRELVVFYITY------------KLSQRNYPLDHIVLNEPPHRTAG
A0A8C5D4L1_BCL2L1-      MAPVNRELVKFFLCH------------RLAQRDFPTSPLRLQDTRDRTV-
A0A8C5D4L1_BCL2L1-      MAPVNRELVKFFLCH------------RLAQRDFPTSPLRLQDTRDRTV-
A0A8C5D4L1_BCL2L1-      MAPVNRELVKFFLCH------------RLAQRDFPTSPLRLQDTRDRTV-
                            . : . :                .  *.: * .   :: .      

A0A8C5H9Y5_MCL1-02      NIASSETPKRPKNLSVASTFVPKALREDSEDMEDGSLPCTPEVHSDTEAE
A0A8C5H9Y5_MCL1-01      NIASSETPKRPKNLSVASTFVPKALREDSEDMEDGSLPCTPEVHSDTEAE
A0A8C5G971_BCL2L1-      SDAEPAEDERTDT--------------QSNGTLNASPVQQQRLPSATSLD
A0A8C5D4L1_BCL2L1-      ----VEKEKASPT--------------AGNGLQDRDGVIPPR-HGDDDVE
A0A8C5D4L1_BCL2L1-      ----VEKEKASPT--------------AGNGLQDRDGVIPPR-HGDDDVE
A0A8C5D4L1_BCL2L1-      ----VEKEKASPT--------------AGNGLQDRDGVIPPR-HGDDDVE
                                : . .               .:.  : .        .  . :

A0A8C5H9Y5_MCL1-02      VSNCSGGAEVLENDTRQLMSRFLADYTGLSKR-DWNESKALSTMKRVVED
A0A8C5H9Y5_MCL1-01      VSNCSGGAEVLENDTRQLMSRFLADYTGLSKR-DWNESKALSTMKRVVED
A0A8C5G971_BCL2L1-      AVK-----EALRDTANEFELRYSLAFSDLHSQLHITPATAYQSFENVMDE
A0A8C5D4L1_BCL2L1-      AVK-----LALVESADEFELLFTQAFNDLATQLQITPDTAYSSFKSVMDE
A0A8C5D4L1_BCL2L1-      AVK-----LALVESADEFELLFTQAFNDLATQLQITPDTAYSSFKSVMDE
A0A8C5D4L1_BCL2L1-      AVK-----LALVESADEFELLFTQAFNDLATQLQITPDTAYSSFKSVMDE
                        . :      .* : : ::   :   :..* ..   .  .* .::: *:::

A0A8C5H9Y5_MCL1-02      VLEKHRYAYNGMVNKLSLDNCSDDMTFVSAVAKSLFADQRTNWGRIASLV
A0A8C5H9Y5_MCL1-01      VLEKHRYAYNGMVNKLSLDNCSDDMTFVSAVAKSLFADQRTNWGRIASLV
A0A8C5G971_BCL2L1-      VFR-----------------------------------DGVNWGRIVGLF
A0A8C5D4L1_BCL2L1-      VFK-----------------------------------DGVNWGRIVGLF
A0A8C5D4L1_BCL2L1-      VFK-----------------------------------DGVNWGRIVGLF
A0A8C5D4L1_BCL2L1-      VFK-----------------------------------DGVNWGRIVGLF
                        *:                                    : .*****..*.

A0A8C5H9Y5_MCL1-02      AFGAVVCQHLKERGRSNCVELVGQEISTYLLTEQREWLVKN-NSWDGFVD
A0A8C5H9Y5_MCL1-01      AFGAVVCQHLKERGRSNCVELVGQEISTYLLTEQREWLVKN-NSWDGFVD
A0A8C5G971_BCL2L1-      AFGGALCVECVEKEMSPLVGRIVEWMTVYLDNHIQPWIQSQ-GGWERFAE
A0A8C5D4L1_BCL2L1-      VFGGVLCLECSEKDMSELVPRIADWMTMYLDENINEWIESEGGGWASFAQ
A0A8C5D4L1_BCL2L1-      VFGGVLCLECSEKDMSELVPRIADWMTMYLDENINEWIESEGGGWRT--T
A0A8C5D4L1_BCL2L1-      VFGGVLCLECSEKDMSELVPRIADWMTMYLDENINEWIESEGGGWASFAQ
                        .**..:*    *.  *  *  : : :: **    . *: .: ..*     

A0A8C5H9Y5_MCL1-02      FFRVADPESTVRNTLMAFAGFAGIGATLAFLIR-----------------
A0A8C5H9Y5_MCL1-01      FFRVADPESTVRNTLMAFAGFAGIGATLAFLIRRACGCLKNEKACKRGRR
A0A8C5G971_BCL2L1-      VFG-QDAVAEIRRSEESFKKWLLVGMTVVTGVVVGSLFAQKRL-------
A0A8C5D4L1_BCL2L1-      IFG-QDAAAKARKARTSMKRWFLFGAVVLTGVLFLVCYVKRREPHLWVTY
A0A8C5D4L1_BCL2L1-      LMG-HIPHIAEHSAS-------VIPGNISVGWM-----------------
A0A8C5D4L1_BCL2L1-      IFG-QDAAAKARKARTSMKRWFLFGAVVLTGVLFLVCYVKRR--------
                        .:    .    . :         .   :                      

A0A8C5H9Y5_MCL1-02      ------------------------------
A0A8C5H9Y5_MCL1-01      RHQRKGKSDPLFRQSEPRGSETKETRSAM-
A0A8C5G971_BCL2L1-      ------------------------------
A0A8C5D4L1_BCL2L1-      LTLLNTAPLSYQEIFLLDGCNITSSSIPHS
A0A8C5D4L1_BCL2L1-      ------------------------------
A0A8C5D4L1_BCL2L1-      ------------------------------
                                                      

© 1998-2022Legal notice