Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------efgy---------ly--gag--ag-gga-ppg------------------------------------
maaaaaaamtdcm--lkrnavirlnilvg---lg--s---t---gylngteseeserrelllepepepepeeeppriggg
  tpgstpaaag-av-rgsgpggrrh-cpwyegetmevapggatdrglalakdalapef                 rtfs
  h  r gydrravagfygyklhyk-vqr r wtpatppsaerlrqamra g  f t d                 prap
        d nali m v     q msdq   rdm dd lvdd h                                   
               d         g  c       a   r   e                                   
                                            a                                   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eagaviggsagasppstltpepglvegppgigaivaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihsse
plapqphvts spqsqeeeedsrrfard pd rl                                             h
dg  gl pgp  agqrftqvsdei ssq nw                                                g
                  a a    q g                                                    
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vpeleaikarvremaptrraapleeeeaeklkelqnpvekqmnmspppgnagpvvmsilekmgadarsistdgyvgnvdy
dwdvt tpd llff           m  paadaimseeaeldgye ellgkr ailplerlveesgndt    slpstpp
t hpa sr                    artsp  t a pgaaag a spvp   hlt  qa d         fsrryrr
g                                                                               
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------rlcadylgyvkqmp------gfgpskavrtllrvafsvqrnvetnf-s-l--v------
gateeelelhfhgcgsvnrvtieaqtfsqdtlpigyivcqpestsretsevsrklgeglfkerqkk-q-c-dn-nvqlhv
pfeamsdqayrqsleiis yltvvdkgakhpvgfars ats asdktsldsvqasddarvdghhialkgmyrkldi   n
d a   s   ltpftarg faa qeelvr karwkgy  rf p gvppeap nqemspal qiarwvrrwvsgyss   k
                       l   f  g nq     ga   egmca a h a r  g  f ls fftflicpg    
                              c  e     f                a        r d kaid aa    
                                                                     a c        
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---varklfnrvmistfddGi-nwgrivttfnfggslskk------------------yqifnsvptyreysyrvra---
sidtiptrtsqpgeketer-fpraryrarltaynsirirfgplvtarwkkwgfqpllrqsgapdrdrgkvlrgfaaeflm
ttedv---------hvpsp -i-------iis-eafva-h               svn-k---qesciqpi--sitsviv
rpq--vysntslst-lqqn vtt  wv f--- -----p-               r kl-tid-----e--ae---dy e
nngstqsmlrh lsws gg pr    l avvv aptmrer                  kemg vqrqv-rfvrwmw-r  
lf mdkq ad  hdei c        d  fet   a lal                  fdee lagdcag callv    
ke l el       d                l     c e                  e    h e a     ccs    
     a                                                                          

       410       420       430       440       450       460       470      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
     *                                                                      
---rsWlsqy-gw--------------------------v-g---g---l--------------------------
nntte irpqg--dngfvkffhvedleggirsvlmtflg-t-vlt-lay-kkryyvltglisltvmetiantyfyf
rtkgd yvknr  eke tekyeppfplefwkngwlawaesatkiaeavlrirtvtcgaffafk             
trlfa f---   g   chl rtga  aar trevqahvhrpigvkslahwtqpmae                   
gqha   qss   a    a  gd        lq sn fsgclmtsimytgldlll                     
       hlk                     kl gl  n  clsnaiis ha kc                     
        a                             l    al f   g                         
                                            c                               
© 1998-2022Legal notice