Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      *                   ..                                    
---t-----d-r-lv-dy-qykLrqrg------yvggagpgagp--a-p-------------------------------
mmm-pcsfp-t-r--q--vmfv qrpqviglnl------lesasgg-t-phqrmratgdefetrfrrtfsdlaaqlhvtp
 aaadaeagyiyaraatflgdg kinayrwdagdccyvpr e tpapd lggall aek asa reigggeag viggsa
  h grtgyvnqwierktmh p sekteel  d l aca  p   e                                  
        m d e  m  ia                                                            
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihssggwalfaimyr
 asppstltpdsrrvarp pi ae                     d tatparllffap  r apleemeapeeetalsp
                                                                         ad  kag
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
vreleeyepkplgkrpavlpllelvnevgnqtstspsppstppvarsleepnyassrtiyvryvrlqataakdtkpmgrs
egamdgeaee           k  qg sekdmnmdgplgpgifssqrirtkmwrqvlsvvtgtspygtpgepleahgpgl
de                                    anag pimpghdglp da erls nlde  l  ega afhac
                                             eee  ehe a  d ia a a               
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                        . .     
----rktsrvlrrvgd-vqr-heknfq-ml-ylnvvsedtvrtl---vmeklfsdgv-------nwgrivtlvtf-----
gavssvallt-qkaa-s---nvrtalks--rnvdikni--a---fsr--ihv-r---lsdspgt--------fsvagtll
sstp----e-d----fglske-----agcsdk------ed-kss nqlv--eme si      it   vikiia      
 p ntpvi-c kss arfrqrypsg -ey s-phntpk s  gr lt lvs- -         p    q af e      
    p eha   q   d   i  rf sa  gqiglsff       aa d e  a                   d      
       a    f           d        efrd             a                             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    ..                                                                          
--gaivakklktqqqepdv-----------kplaysvtevlmrttr-wlvqqggwdg-fveff---------rnvl--fa
eregflish-lriniascikeqegdvadtyeeisefiadfivnnk-e-irknr----g-----hvedleggw----la--
  kpvmcvsw---------        rdc---------------gdy-q---nyns srsryrpssrwmfilswtvqyv
    litarsvqwipsrtn           rrgvswtssyfpgqrht r-rtt  gn  ckl gtpmppltfhkq smlt
     f  e tnvgmq rl           qn iltmdrr n hl a  ad    ek   hk e kfgla dfeh plks
           krefk l            d   all  g   ah     a     a                   gkif
                                                                              ac

       410       420    
....:....|....:....|....
                        
gvasvlkglcyl------------
ls-llga--a--irayltswyspy
e-vg---ry-itwtrraghk    
-ms-rpvqrvarlg l        
 lnahktakm  g           
 fl aar fi              
  c     a               
© 1998-2020Legal notice