Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------t--mfgy---------lyv-gag--agegpa--pg-rlladyleyverrp--------------------
mmaapasapm-rcevalkrnyvlrqril-g---lg------tp--gygaqtesqetlqielllepepepepeeepprrtg
 ahtaragadadgla-grvsakiglngvcpwregepmspgpagalhqanrlakgasapef                 igf
    g t yanaaa-mdfgggpgsrkh ecd  rvtavdalgdrtdgimgaqgdhlptpg                 pra
            e-  -yih      m dw   dtg a  gre ap  fssgpkdfkhmd                    
             i  k            q            a  e      a  c   a                    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
selaavlgvtpgasqqstttvssrlvqgpppwgalvaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihss
gdagpqihgsa sapprflqpepgrferg ni ri                                             
ppg  gp pgs  pgsqeeeedde  a d gd                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
evpeleaikarvremaptrraapleeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsistdgyvgnvd
ggwdvt tp  llff           m  paadaimspe eldgye e lgkr avlpll lvgesgndt    slpstp
 d a                                                                            
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------ypgstpskalrtlrrvgesvqrnvetnfqsmldnv--v--dtvk
ygataeeleahfhscgsvnrvtilqdkfsghpkgfgrsefssretvevslkladglfkgrqkklkgc---lnv-sivipr
pp ee  d lyrqgleiis ylrecatgakdtapmaqisagdkvsslevqasdfdrwaehria----vrk-dlktf--a-
            a rdr a tsp  tpa pga agpttapygptvhaaa qaraans syhrvvtfaysgysitnetd-g
                                   efl lv dgpe         fl ri  s fewslqgpsnrvelra
                                    a                     q   d d kailchglpq a  
                                                                a   ci a        
                                                                    a           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                               :
rl-nrvmistfedgv-nwgrivttfnfngslskk-------------------qifnsvptyrvisyrvte------rsW
ttf-qpgeketdr-ipraryrarltaygsirirfgplvtarwkkwgfqpllrysgapdrdrgkeyrgfaraflmrntgef
--as-----vps- fi-------i---e------               r kq----qescieplaesiasvivntktd 
sm dt vshl--p -tt   v a-is -afvavh                  sktie-------------dy ngqlha 
lf as l e- r  pr       fvt a vmler                  lvnrdvsrlvqrfvrwmw-r   hh t 
        ds g             e   t c e                  e eg mqedcdn cllls          
           c                                             ha  aag  acc           
                                                                                

       410       420       430       440       450       460       470
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      
isqn-gw----------------------------g-------l--------------------------
yrpyg--dngfvkffhvedplggirsvlltfllvt-viaglay-krrlycltglifltvmetiantyfyf
lvkqr  ekfveekgepprleffwkngwmawagsaplgvesltrikypmhk                   
fq--   ga  cly rtmf  adfswqsvqthehllkvtamishwttklae                   
 -sk        h  ps        kl  kafn camsskivl ldq g                     
 ad                                 ilnif a ga                        
  a                                  ag c                             
                                      c                               
© 1998-2022Legal notice