Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YPX6_BCL2L2-      ---------MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGE
A0A2I2YQH7_MCL1-01      ---------------------------MFGLKRNAVIGLNLYCGGAGLGA
G3QES9_BCL2-01          --------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAVPPGA
A0A2I2YML2_BCL2A1-      ----------MTDCEFGYIYRLAQDYLQYVL-------------------
A0A2I2YML2_BCL2A1-      ----------MTDCEFGYIYRLAQDYLQYVL-------------------
A0A2I2YPX6_BCL2L2-      ---------MATPASAPDTRALVADFVGYKLRQKGY--------------
A0A2I2YQH7_MCL1-03      -----------MFGLKRNAVIGLNLYCGG---------------------
G3QLU6_BCL2L10-01       MVDQWRERTTMADPLRERTERLLADYLGY---------------------
                                                                          

A0A2I2YPX6_BCL2L2-      GP-AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSD
A0A2I2YQH7_MCL1-01      GSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDS
G3QES9_BCL2-01          APAPGIFSSQPGHTPHPAASRDRVARTSPLQTPAAPGAAAGPA-------
A0A2I2YML2_BCL2A1-      ---------------------------------QIPQPGSG---------
A0A2I2YML2_BCL2A1-      ---------------------------------QIPQPGSG---------
A0A2I2YPX6_BCL2L2-      --------------------------------VCGAGPGEGPA-------
A0A2I2YQH7_MCL1-03      ---------------------------------AGLGAGSGGA-------
G3QLU6_BCL2L10-01       ---------------------------------CAREPGTPEP-------
                                                             ..           

A0A2I2YPX6_BCL2L2-      ELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRL
A0A2I2YQH7_MCL1-01      RRVARPPPIGAEV-------------------PDVTATPARLLFFAPTRR
G3QES9_BCL2-01          --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
                                                                          

A0A2I2YPX6_BCL2L2-      ADWIHSSGGWELEAIKARVREMEEEAEK----------LKELQNEVEKQM
A0A2I2YQH7_MCL1-01      AAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNDT
G3QES9_BCL2-01          --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
                                                                          

A0A2I2YPX6_BCL2L2-      NMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGS
A0A2I2YQH7_MCL1-01      STDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGA
G3QES9_BCL2-01          ---------------------------LSPV-------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YQH7_MCL1-03      ---------------------------TPPGGRLLATGAKDTKPMGRSGA
G3QLU6_BCL2L10-01       ---------------------------TP---------------------
                                                                          

A0A2I2YPX6_BCL2L2-      VNRVTILCDKFSG------HPKGFA----YIE-FSDKESVRTSLALDESL
A0A2I2YQH7_MCL1-01      TSRKALETLRRVGDGVQRNHETAFQGMLRKLD-IKNEDDVKSLSRVMIHV
G3QES9_BCL2-01          -PPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH-LTPFTARGRFATVVEEL
A0A2I2YML2_BCL2A1-      -PSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKE
A0A2I2YML2_BCL2A1-      -PSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKE
A0A2I2YPX6_BCL2L2-      -ADPLHQAMRAAGDEFETRFRRTFSDLAAQLH-VTPGSAQQRFTQVSDEL
A0A2I2YQH7_MCL1-03      TSRKALETLRRVGDGVQRNHETAFQGMLRKLD-IKNEDDVKSLSRVMIHV
G3QLU6_BCL2L10-01       -STPEAAVLRSAAARLRQIHRSFFSAYLGYPG-NRFE---------LVAL
                                 .  .          :                          

A0A2I2YPX6_BCL2L2-      FR------------GRQIK-VDF-------KAIICSSLTQVIPKRTN---
A0A2I2YQH7_MCL1-01      FSDGV------TNWGRIVTLISF-------GAFVAKHLKTINQESCI---
G3QES9_BCL2-01          FRDG-------VNWGRIVAFFEF-------GGVMCVESVNREMSPLV---
A0A2I2YML2_BCL2A1-      FEDGI------INWGRIVTIFAF-------EGILIKKLLRQQIAPDV---
A0A2I2YML2_BCL2A1-      FEDGI------INWGRIVTIFAF-------EGILIKKLLRQQIAPDV---
A0A2I2YPX6_BCL2L2-      FQGG-------PNWGRLVAFFVF-------GAALCAESVNKEMEPLV---
A0A2I2YQH7_MCL1-03      FSDGV------TNWGRIVTLISF-------GAFVAKHLKTINQESCI---
G3QLU6_BCL2L10-01       MADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQ
                        :             ** :  . *          :                

A0A2I2YPX6_BCL2L2-      --------RPGISTTDRGFPRAR--YRARTTNYNSSRSRF----------
A0A2I2YQH7_MCL1-01      --------EPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLE----
G3QES9_BCL2-01          --------DNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP----
A0A2I2YML2_BCL2A1-      -----DTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSG----
A0A2I2YML2_BCL2A1-      -----DTYKEISYFVAEFIMNNTGEWIRQNGGWGK---------------
A0A2I2YPX6_BCL2L2-      --------GQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARR
A0A2I2YQH7_MCL1-03      --------EPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLE----
G3QLU6_BCL2L10-01       EGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPL----
                                          :      :     .:                 

A0A2I2YPX6_BCL2L2-      ---------------YSGFNSRPRGRVYRGRARATSWYSPY
A0A2I2YQH7_MCL1-01      ------GGIRNVLLAFAGVAGVGAGLAYLIR----------
G3QES9_BCL2-01          -LFDFSWLSLKTLLSLALVGACITLGAYLGHK---------
A0A2I2YML2_BCL2A1-      ------------WMTFLEVTGKICEMLSLLKQYC-------
A0A2I2YML2_BCL2A1-      ---------------WHNHTPMLVESVAHKKRKMAL-----
A0A2I2YPX6_BCL2L2-      LREGNWASVRTVLTGAVALGALVTVGAFFASK---------
A0A2I2YQH7_MCL1-03      ------GGIRNVLLAFAGVAGVGAGLAYLIR----------
G3QLU6_BCL2L10-01       ------AFWRKQLVQAFLSCLLATAFIYLWTRLL-------
                                                                 

© 1998-2020Legal notice