Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3QES9_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAVPPGAAP------
A0A2I2YML2_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ------------PGSGP------
A0A2I2YML2_BCL2A1-      --MTDCEFGYIYRLAQDYLQYVLQIPQ------------PGSGP------
A0A2I2YQH7_MCL1-03      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPP
G3QLU6_BCL2L10-01       --------MVDQWRERTTMADPLRERTERLLADYLGYCAREPGTPEPTP-
A0A2I2YPX6_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGEGP-AADPL
A0A2I2YPX6_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YVCGAGPGEGP-AADPL
A0A2I2YQH7_MCL1-01      -------------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPP
                                              *                   ..      

G3QES9_BCL2-01          --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YQH7_MCL1-03      GGRLLATG------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YPX6_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPN
A0A2I2YPX6_BCL2L2-      HQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPN
A0A2I2YQH7_MCL1-01      GGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPP
                                                                          

G3QES9_BCL2-01          --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YPX6_BCL2L2-      WGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSG
A0A2I2YPX6_BCL2L2-      WGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSG
A0A2I2YQH7_MCL1-01      IGAEV-------------------PDVTATPARLLFFAPTRRAAPLEEME
                                                                          

G3QES9_BCL2-01          ------------------------------------------------AP
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YPX6_BCL2L2-      GWAEFTALYGDGALEE----------------------------------
A0A2I2YPX6_BCL2L2-      GWELEAIKARVREMEEEAEK----------LKELQNEVEKQMNMSPPPGN
A0A2I2YQH7_MCL1-01      APAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNDTSTDGSLPS
                                                                          

G3QES9_BCL2-01          GIFSSQPGHTPHPAASRDRVARTSPLQTPAAPGAAAGPALSPVPPVVHLT
A0A2I2YML2_BCL2A1-      --------------------------------------------SKTSRV
A0A2I2YML2_BCL2A1-      --------------------------------------------SKTSRV
A0A2I2YQH7_MCL1-03      ------------------------------AKDTKPMGRSGATSRKALET
G3QLU6_BCL2L10-01       -------------------------------------------STPEAAV
A0A2I2YPX6_BCL2L2-      ----ARRLREGNWASVRTVLTGAVALGAL---------------------
A0A2I2YPX6_BCL2L2-      AGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILC
A0A2I2YQH7_MCL1-01      TPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALET
                                                                          

G3QES9_BCL2-01          LRQAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATVVEELFRDGV---
A0A2I2YML2_BCL2A1-      LQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGI---
A0A2I2YML2_BCL2A1-      LQKVAFSVQKEVEKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGI---
A0A2I2YQH7_MCL1-03      LRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDGV---
G3QLU6_BCL2L10-01       LRSAAARLRQIHRSFFSAYLGYPGNRFE----------LVALMADSVLSD
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      DKFSG------HPKGFA----YIEFSDKESVRTS-LALDESLFR------
A0A2I2YQH7_MCL1-01      LRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDGV---
                                                                          

G3QES9_BCL2-01          ----NWGRIVAFFEF-------GGVMCVESVNREMSPLV-----------
A0A2I2YML2_BCL2A1-      ---INWGRIVTIFAF-------EGILIKKLLRQQIAPDV--------DTY
A0A2I2YML2_BCL2A1-      ---INWGRIVTIFAF-------EGILIKKLLRQQIAPDV--------DTY
A0A2I2YQH7_MCL1-03      ---TNWGRIVTLISF-------GAFVAKHLKTINQESCI-----------
G3QLU6_BCL2L10-01       SPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDC
A0A2I2YPX6_BCL2L2-      ------------VTV-------GAFFASK---------------------
A0A2I2YPX6_BCL2L2-      ------GRQIK-VDF-------KAIICSSLTQVIPKRTN-----------
A0A2I2YQH7_MCL1-01      ---TNWGRIVTLISF-------GAFVAKHLKTINQESCI-----------
                                    . .         ..                        

G3QES9_BCL2-01          DNIALWMTEYLNRHLHTWIQDNGGWDA-FVELYGPSMRPLFDFSWLSLKT
A0A2I2YML2_BCL2A1-      KEISYFVAEFIMNNTGEWIRQNGGWGK--------------WHNHTPMLV
A0A2I2YML2_BCL2A1-      KEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKIC
A0A2I2YQH7_MCL1-03      EPLAESITDVLVRTKRDWLVKQRGWDG-FVEFFHVEDLEGGIRNVLLAFA
G3QLU6_BCL2L10-01       QRLVALLSSRLMGQHRAWLQAQGGWDG-FCHFFRTPFPLAFWRKQLVQAF
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      RPGISTTDRGFPRAR--YRARTTNYNS-SRSRF---------------YS
A0A2I2YQH7_MCL1-01      EPLAESITDVLVRTKRDWLVKQRGWDG-FVEFFHVEDLEGGIRNVLLAFA
                                                                          

G3QES9_BCL2-01          LLSLALVGACITLGAYLGHK----
A0A2I2YML2_BCL2A1-      ESVAHKKRKMAL------------
A0A2I2YML2_BCL2A1-      EMLSLLKQYC--------------
A0A2I2YQH7_MCL1-03      GVAGVGAGLAYLIR----------
G3QLU6_BCL2L10-01       LSCLLATAFIYLWTRLL-------
A0A2I2YPX6_BCL2L2-      ------------------------
A0A2I2YPX6_BCL2L2-      GFNSRPRGRVYRGRARATSWYSPY
A0A2I2YQH7_MCL1-01      GVAGVGAGLAYLIR----------
                                                

© 1998-2020Legal notice