Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3QES9_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAVPPGAAPAPGIFS
G3QLU6_BCL2L10-01       --------------------------MVDQWRERTTMADPLRERTERLLA
A0A2I2YQH7_MCL1-03      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2I2YML2_BCL2A1-      ---------MTDCEFGY---------IY------------------RLAQ
A0A2I2YML2_BCL2A1-      ---------MTDCEFGY---------IY------------------RLAQ
A0A2I2YML2_BCL2A1-      ---------MTDCEFGY---------IY------------------RLAQ
A0A2I2YPX6_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMR
A0A2I2YQH7_MCL1-02      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2I2YQH7_MCL1-01      -------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLA
A0A2I2YPX6_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMR
A0A2I2YPX6_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
A0A2I2YPX6_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNG
                                                                          

G3QES9_BCL2-01          SQPGHTPHPA----------------------------------------
G3QLU6_BCL2L10-01       DYLGYCAREP----------------------------------------
A0A2I2YQH7_MCL1-03      TGAKDTKPMG----------------------------------------
A0A2I2YML2_BCL2A1-      DYLQYVLQIP----------------------------------------
A0A2I2YML2_BCL2A1-      DYLQYVLQIP----------------------------------------
A0A2I2YML2_BCL2A1-      DYLQYVLQIP----------------------------------------
A0A2I2YPX6_BCL2L2-      AAGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQ
A0A2I2YQH7_MCL1-02      TEKEASARRE-----------------IGGGEAGAVIGGSAGASPPSTLT
A0A2I2YQH7_MCL1-01      TEKEASARRE-----------------IGGGEAGAVIGGSAGASPPSTLT
A0A2I2YPX6_BCL2L2-      AAGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQ
A0A2I2YPX6_BCL2L2-      LESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEE
A0A2I2YPX6_BCL2L2-      LESEELEPED------------------------------------QEEE
                                                                          

G3QES9_BCL2-01          --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLE
A0A2I2YQH7_MCL1-02      PDSRRVARPPPIGA------------------------------------
A0A2I2YQH7_MCL1-01      PDSRRVARPPPIGA------------------------------------
A0A2I2YPX6_BCL2L2-      VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLE
A0A2I2YPX6_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
A0A2I2YPX6_BCL2L2-      EEPGLVEGDPGDGAI-----------------------------------
                                                                          

G3QES9_BCL2-01          --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      TRLADWIHSSGGWA------------------------------------
A0A2I2YQH7_MCL1-02      ----------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEE
A0A2I2YQH7_MCL1-01      ----------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEE
A0A2I2YPX6_BCL2L2-      TRLADWIHSSGGWELEAIKARVREM----------EEEAEKLKELQNEVE
A0A2I2YPX6_BCL2L2-      ----------EDPELEAIKARVREM----------EEEAEKLKELQNEVE
A0A2I2YPX6_BCL2L2-      ----------EDPELEAIKARVREM----------EEEAEKLKELQNEVE
                                                                          

G3QES9_BCL2-01          --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YQH7_MCL1-03      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YML2_BCL2A1-      --------------------------------------------------
A0A2I2YPX6_BCL2L2-      --------------------------------------------------
A0A2I2YQH7_MCL1-02      ELDGYEPEPLGKRPAVLPLLELVGESGNDTSTDGSLPSTPPPAEEEEDEL
A0A2I2YQH7_MCL1-01      ELDGYEPEPLGKRPAVLPLLELVGESGNDTSTDGSLPSTPPPAEEEEDEL
A0A2I2YPX6_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSI----YVGNVDYGATAEELEA
A0A2I2YPX6_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSI----YVGNVDYGATAEELEA
A0A2I2YPX6_BCL2L2-      KQMNMSPPPGNAGPVIMSIEEKMEADARSI----YVGNVDYGATAEELEA
                                                                          

G3QES9_BCL2-01          --ASRDRVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRY
G3QLU6_BCL2L10-01       -------------------------GTPEPTPSTPEAAVLRSAAARLRQI
A0A2I2YQH7_MCL1-03      --------------------------RSGATSRKALETLRRVGDGVQRNH
A0A2I2YML2_BCL2A1-      --------------------------QPGSGPSKTSRVLQKVAFSVQKEV
A0A2I2YML2_BCL2A1-      --------------------------QPGSGPSKTSRVLQKVAFSVQKEV
A0A2I2YML2_BCL2A1-      --------------------------QPGSGPSKTSRVLQKVAFSVQKEV
A0A2I2YPX6_BCL2L2-      -------------------------EFTALYGDGALEEARRLREGNWASV
A0A2I2YQH7_MCL1-02      YRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNH
A0A2I2YQH7_MCL1-01      YRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNH
A0A2I2YPX6_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A2I2YPX6_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
A0A2I2YPX6_BCL2L2-      HFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
                                                                          

G3QES9_BCL2-01          RRDFAEMSSQLHLTPFTARGRF-ATVVEELFRDGV-NWGRIVAFFEFGGV
G3QLU6_BCL2L10-01       HRSFFSAYLGYPGNRFELVALMADSVLSDSPGP---TWGRVVTLVTFAGT
A0A2I2YQH7_MCL1-03      ETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDGVTNWGRIVTLISFGAF
A0A2I2YML2_BCL2A1-      EKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGI
A0A2I2YML2_BCL2A1-      EKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGI
A0A2I2YML2_BCL2A1-      EKNLKSCLDNVNVVSIDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGI
A0A2I2YPX6_BCL2L2-      RTVLTGAVALGALVTV----------------------------------
A0A2I2YQH7_MCL1-02      ETAFQGWVCGV------------------LPCRGPRRW------------
A0A2I2YQH7_MCL1-01      ETAFQGMLRKLDIKNEDDVKSL-SRVMIHVFSDGVTNWGRIVTLISFGAF
A0A2I2YPX6_BCL2L2-      QIKVDFKAIICSSLTQVIPKRT-NRPGISTTDRGFPRARYRARTTNYNSS
A0A2I2YPX6_BCL2L2-      QIK-------------VIPKRT-NRPGISTTDRGFPRARYRARTTNYNSS
A0A2I2YPX6_BCL2L2-      QIK-------------VIPKRT-NRPGISTTDRGFPRARYRARTTNYNSS
                                                                          

G3QES9_BCL2-01          MCVE------------------SVNREMSPLVDNIALWMTEYLNRHLHTW
G3QLU6_BCL2L10-01       LLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAW
A0A2I2YQH7_MCL1-03      VAKH---------------L---KTINQESCIEPLAESITDVLVRTKRDW
A0A2I2YML2_BCL2A1-      LIKK---------------LLRQQIAPDVDTYKEISYFVAEFIMNNTGEW
A0A2I2YML2_BCL2A1-      LIKK---------------LLRQQIAPDVDTYKEISYFVAEFIMNNTGEW
A0A2I2YML2_BCL2A1-      LIKK---------------LLRQQIAPDVDTYKEISYFVAEFIMNNTGEW
A0A2I2YPX6_BCL2L2-      -----------------------------------------------GAF
A0A2I2YQH7_MCL1-02      ---------------------------HQECAAGFCRCCWS------RSW
A0A2I2YQH7_MCL1-01      VAKH------------------LKTINQESCIEPLAESITDVLVRTKRDW
A0A2I2YPX6_BCL2L2-      RSRF------------------YSGFNSRPRGRVYRGRARA------TSW
A0A2I2YPX6_BCL2L2-      RSRF------------------YSGFNSRPRGRVYRGRARA------TSW
A0A2I2YPX6_BCL2L2-      RSRF------------------YSGFNSRPRGRVYRGRARA------TSW
                                                                         :

G3QES9_BCL2-01          IQDNGGWD-AFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLG
G3QLU6_BCL2L10-01       LQAQGGWD-GFCHFFRTPFPLAFWRKQLVQAFLSCLLATAFIYLWTRLL-
A0A2I2YQH7_MCL1-03      LVKQRGWD-GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR----
A0A2I2YML2_BCL2A1-      IRQNGGWENGFVKKFEP-------KSGWMTFLEVTGKISILLTRKDTPYC
A0A2I2YML2_BCL2A1-      IRQNGGWGK---------------------WHNHTPMLVESVAHKKRKMA
A0A2I2YML2_BCL2A1-      IRQNGGWENGFVKKFEP-------KSGWMTFLEVTGKICEMLSLLKQYC-
A0A2I2YPX6_BCL2L2-      FASK----------------------------------------------
A0A2I2YQH7_MCL1-02      F----------------------------------GISNKIALL------
A0A2I2YQH7_MCL1-01      LVKQRGWD-GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR----
A0A2I2YPX6_BCL2L2-      YSPY----------------------------------------------
A0A2I2YPX6_BCL2L2-      YSPY----------------------------------------------
A0A2I2YPX6_BCL2L2-      YSPY----------------------------------------------
                                                                          

G3QES9_BCL2-01          HK------------------
G3QLU6_BCL2L10-01       --------------------
A0A2I2YQH7_MCL1-03      --------------------
A0A2I2YML2_BCL2A1-      ETGLIFLTVMETIANTYFYF
A0A2I2YML2_BCL2A1-      L-------------------
A0A2I2YML2_BCL2A1-      --------------------
A0A2I2YPX6_BCL2L2-      --------------------
A0A2I2YQH7_MCL1-02      --------------------
A0A2I2YQH7_MCL1-01      --------------------
A0A2I2YPX6_BCL2L2-      --------------------
A0A2I2YPX6_BCL2L2-      --------------------
A0A2I2YPX6_BCL2L2-      --------------------
                                            

© 1998-2020Legal notice