Dataset for protein BCL-2-like of organism Gorilla gorilla gorilla

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I2YPX6_BCL2L2-      ----------------------------------MATPASAPDTR-----
G3QLU6_BCL2L10-01       -------------------------MVDQWRERTTMADPLRERTE-----
A0A2I2YJ87_MCL1-03      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGG-----
A0A2I2YJV4_BCL2A1-      --------MTDCEFGY---------IY-----------------------
A0A2I2YJV4_BCL2A1-      --------MTDCEFGY---------IY-----------------------
A0A2I2YJV4_BCL2A1-      --------MTDCEFGY---------IY-----------------------
G3QES9_BCL2-01          MAHAGRTGYDNREIVMKY---IHYKLSQRGYEWDAGDVGAVPPGA-----
A0A2I2YJ87_MCL1-02      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT
A0A2I2YJ87_MCL1-01      ------------MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLAT
A0A2I2YPX6_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAG--PGEGPAADPLHQAMRA
A0A2I2YPX6_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
A0A2I2YPX6_BCL2L2-      MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL
                                                                          

A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YJ87_MCL1-03      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
G3QES9_BCL2-01          ------------------------------------------------AP
A0A2I2YJ87_MCL1-02      EKEASARRE-----------------IGGGEAGAVIGGSAGASPPSTLTP
A0A2I2YJ87_MCL1-01      EKEASARRE-----------------IGGGEAGAVIGGSAGASPPSTLTP
A0A2I2YPX6_BCL2L2-      AGDEFETRF----------------RRTFSDLAAQLHVTPGSAQQRFTQV
A0A2I2YPX6_BCL2L2-      ESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
A0A2I2YPX6_BCL2L2-      ESEELEPED------------------------------------QEEEE
                                                                          

A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YJ87_MCL1-03      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
G3QES9_BCL2-01          APGIFSSQPG----------------------------------------
A0A2I2YJ87_MCL1-02      DSRRVARPPPIGA-------------------------------------
A0A2I2YJ87_MCL1-01      DSRRVARPPPIGA-------------------------------------
A0A2I2YPX6_BCL2L2-      SDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLET
A0A2I2YPX6_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
A0A2I2YPX6_BCL2L2-      EPGLVEGDPGDGAI------------------------------------
                                                                          

A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YJ87_MCL1-03      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
G3QES9_BCL2-01          ---------HTPHPAASRDRV-----------------ARTSPLQTPAAP
A0A2I2YJ87_MCL1-02      ---------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEE
A0A2I2YJ87_MCL1-01      ---------EVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEE
A0A2I2YPX6_BCL2L2-      RLADWIHSSGGWELEAIKARVREM----------EEEAEKLKELQNEVEK
A0A2I2YPX6_BCL2L2-      ---------EDPELEAIKARVREM----------EEEAEKLKELQNEVEK
A0A2I2YPX6_BCL2L2-      ---------EDPELEAIKARVREM----------EEEAEKLKELQNEVEK
                                                                          

A0A2I2YPX6_BCL2L2-      --------------------------------------------------
G3QLU6_BCL2L10-01       --------------------------------------------------
A0A2I2YJ87_MCL1-03      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
A0A2I2YJV4_BCL2A1-      --------------------------------------------------
G3QES9_BCL2-01          GAAAGPALSPVPPVVHLTLRQAGDD--------FSRRYRRDFAEMSSQLH
A0A2I2YJ87_MCL1-02      LDGYEPEPLGKRPAVLPLLELVGESGNDTSTDGSLPSTPPPAEEEEDELY
A0A2I2YJ87_MCL1-01      LDGYEPEPLGKRPAVLPLLELVGESGNDTSTDGSLPSTPPPAEEEEDELY
A0A2I2YPX6_BCL2L2-      QMNMSPPPGNAGPVIMSIEEKMEADARSI----YVGNVDYGATAEELEAH
A0A2I2YPX6_BCL2L2-      QMNMSPPPGNAGPVIMSIEEKMEADARSI----YVGNVDYGATAEELEAH
A0A2I2YPX6_BCL2L2-      QMNMSPPPGNAGPVIMSIEEKMEADARSI----YVGNVDYGATAEELEAH
                                                                          

A0A2I2YPX6_BCL2L2-      -----------ALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
G3QLU6_BCL2L10-01       -----------RLLADYLGYCAREPG---TPEPTPSTPEAAVLRSAAARL
A0A2I2YJ87_MCL1-03      -----------RLLATGAKDTKPMG----RSGATSRKALETLRRVGDGVQ
A0A2I2YJV4_BCL2A1-      -----------RLAQDYLQYVLQIP----QPGSGPSKTSRVLQKVAFSVQ
A0A2I2YJV4_BCL2A1-      -----------RLAQDYLQYVLQIP----QPGSGPSKTSRVLQKVAFSVQ
A0A2I2YJV4_BCL2A1-      -----------RLAQDYLQYVLQIP----QPGSGPSKTSRVLQKVAFSVQ
G3QES9_BCL2-01          LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLV
A0A2I2YJ87_MCL1-02      RQSLEIISRYLREQATGAKDTKPMGRS----GATSRKALETLRRVGDGVQ
A0A2I2YJ87_MCL1-01      RQSLEIISRYLREQATGAKDTKPMGRS----GATSRKALETLRRVGDGVQ
A0A2I2YPX6_BCL2L2-      FHGCGSVNRVTILCDKFSGHPKGFAYI----EFSDKESVRTSLALDESLF
A0A2I2YPX6_BCL2L2-      FHGCGSVNRVTILCDKFSGHPKGFAYI----EFSDKESVRTSLALDESLF
A0A2I2YPX6_BCL2L2-      FHGCGSVNRVTILCDKFSGHPKGFAYI----EFSDKESVRTSLALDESLF
                                                                          

A0A2I2YPX6_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP-NWGRLVAF
G3QLU6_BCL2L10-01       RQIHRSFFSAYLGYPG---NRFELVALMADSVLSDSPGP---TWGRVVTL
A0A2I2YJ87_MCL1-03      RNHETAFQGMLRKLDI---KNEDDVKSL-SRVMIHVFSDGVTNWGRIVTL
A0A2I2YJV4_BCL2A1-      KEVEKNLKSCLDNVNV---VSIDTARTLFNQVMEKEFEDGIINWGRIVTI
A0A2I2YJV4_BCL2A1-      KEVEKNLKSCLDNVNV---VSIDTARTLFNQVMEKEFEDGIINWGRIVTI
A0A2I2YJV4_BCL2A1-      KEVEKNLKSCLDNVNV---VSIDTARTLFNQVMEKEFEDGIINWGRIVTI
G3QES9_BCL2-01          DNIALW-----------------MTEYLNRHLHTWIQDNG----GWDAFV
A0A2I2YJ87_MCL1-02      RNHETAFQGWVCGV---------------------LPCRGPRRW------
A0A2I2YJ87_MCL1-01      RNHETAFQGMLRKLDI----KNEDDVKSLSRVMIHVFSDGVTNWGRIVTL
A0A2I2YPX6_BCL2L2-      RGRQIKVDFKAIICSS----LTQVIPKRTNRPGISTTDRGFPRARYRART
A0A2I2YPX6_BCL2L2-      RGRQIK-----------------VIPKRTNRPGISTTDRGFPRARYRART
A0A2I2YPX6_BCL2L2-      RGRQIK-----------------VIPKRTNRPGISTTDRGFPRARYRART
                                                                          

A0A2I2YPX6_BCL2L2-      FVFGAALCAE---------------SVNKEMEPLVGQVQE---WMVAYLE
G3QLU6_BCL2L10-01       VTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLM
A0A2I2YJ87_MCL1-03      ISFGAFVAKH---------------L---KTINQESCIEPLAESITDVLV
A0A2I2YJV4_BCL2A1-      FAFEGILIKK---------------LLRQQIAPDVDTYKEISYFVAEFIM
A0A2I2YJV4_BCL2A1-      FAFEGILIKK---------------LLRQQIAPDVDTYKEISYFVAEFIM
A0A2I2YJV4_BCL2A1-      FAFEGILIKK---------------LLRQQIAPDVDTYKEISYFVAEFIM
G3QES9_BCL2-01          ELYGPSMRPL------------------FD--------------------
A0A2I2YJ87_MCL1-02      ---------------------------------HQECAAGFCRCCWS---
A0A2I2YJ87_MCL1-01      ISFGAFVAKH------------------LKTINQESCIEPLAESITDVLV
A0A2I2YPX6_BCL2L2-      TNYNSSRSRF------------------YSGFNSRPRGRVYRGRARA---
A0A2I2YPX6_BCL2L2-      TNYNSSRSRF------------------YSGFNSRPRGRVYRGRARA---
A0A2I2YPX6_BCL2L2-      TNYNSSRSRF------------------YSGFNSRPRGRVYRGRARA---
                                                                          

A0A2I2YPX6_BCL2L2-      TRLADWIHSSGGWA-EFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
G3QLU6_BCL2L10-01       GQHRAWLQAQGGWD-GFCHFFRTPFPLAFWRKQLVQAFLSCLLATAFIYL
A0A2I2YJ87_MCL1-03      RTKRDWLVKQRGWD-GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYL
A0A2I2YJV4_BCL2A1-      NNTGEWIRQNGGWGK---------------------WHNHTPMLVESVAH
A0A2I2YJV4_BCL2A1-      NNTGEWIRQNGGWENGFVKKFEP-------KSGWMTFLEVTGKISILLTR
A0A2I2YJV4_BCL2A1-      NNTGEWIRQNGGWENGFVKKFEP-------KSGWMTFLEVTGKICEMLSL
G3QES9_BCL2-01          ---FSWLSLK---------------------TLLSLALVGACITLGAYLG
A0A2I2YJ87_MCL1-02      ---RSWF----------------------------------GISNKIALL
A0A2I2YJ87_MCL1-01      RTKRDWLVKQRGWD-GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYL
A0A2I2YPX6_BCL2L2-      ---TSWYSPY----------------------------------------
A0A2I2YPX6_BCL2L2-      ---TSWYSPY----------------------------------------
A0A2I2YPX6_BCL2L2-      ---TSWYSPY----------------------------------------
                             *                                            

A0A2I2YPX6_BCL2L2-      GALVTVGAFFASK-------------
G3QLU6_BCL2L10-01       WTRLL---------------------
A0A2I2YJ87_MCL1-03      IR------------------------
A0A2I2YJV4_BCL2A1-      KKRKMAL-------------------
A0A2I2YJV4_BCL2A1-      KDTPYCETGLIFLTVMETIANTYFYF
A0A2I2YJV4_BCL2A1-      LKQ-YC--------------------
G3QES9_BCL2-01          HK------------------------
A0A2I2YJ87_MCL1-02      --------------------------
A0A2I2YJ87_MCL1-01      IR------------------------
A0A2I2YPX6_BCL2L2-      --------------------------
A0A2I2YPX6_BCL2L2-      --------------------------
A0A2I2YPX6_BCL2L2-      --------------------------
                                                  

© 1998-2021Legal notice