Dataset for protein Bcl-xL of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************.******************************************************
MSQSNRELVVDFLSYKLSQKGYSWSqFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
                         r                                                      
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******:********************                    :  :     ..                     
VLVSRIAtWMATYLNDHLEPWIQENGGWvtf------------velypnnaaaesrkgqer-n-----gqtvsgvvltts
       a                    dwtehqrcarlcapqglhsgeqssqwltssr--t-rwtltpmrsipsmnmrp
                             vi             af   fl pg  l kv shdgqgnkldcccdlglgn
                                                             r aefel  a a  k fcl

       250       260       270       280   
....:....|....:....|....:....|....:....|...
 :                                         
lldrn--------------------------------------
qfsqkltgrdcwpgrwrkpplggsdhsaqlpsqgrssrrrgrc
c pfggs                                    
   aa                                      
© 1998-2020Legal notice