Dataset for protein Bcl-xL of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F5XYW0_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A5F5XYW0_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
A0A5F5XYW0_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q8SQ42_BCL2L1-01        MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSA
                        *************************.************************

A0A5F5XYW0_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A5F5XYW0_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
A0A5F5XYW0_BCL2L1-      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q8SQ42_BCL2L1-01        INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                        **************************************************

A0A5F5XYW0_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A5F5XYW0_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A5F5XYW0_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q8SQ42_BCL2L1-01        YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        **************************************************

A0A5F5XYW0_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTF---------
A0A5F5XYW0_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWVVIEHQRCARLC
A0A5F5XYW0_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWVWT---------
Q8SQ42_BCL2L1-01        CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTF---------
                        *****************:********************            

A0A5F5XYW0_BCL2L1-      ---VELYGNNAAAESRKGQVRTNAETELPQRVCPVLGTTPCLDFAGTGRD
A0A5F5XYW0_BCL2L1-      APQGAHSPEQSSPWSTSSRERRHDGQGNKQDCSGDKLFCNQLPQNLS---
A0A5F5XYW0_BCL2L1-      ---GLFYPEFLAQGLRLGK---------GLASICSMNMRLLLDAG-----
Q8SQ42_BCL2L1-01        ---VELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK-----
                                :  :     ..                      :        

A0A5F5XYW0_BCL2L1-      CWPGRWRKPPLGGSDHSAQLPSQGRSSRRRGRC
A0A5F5XYW0_BCL2L1-      ---------------------------------
A0A5F5XYW0_BCL2L1-      ---------------------------------
Q8SQ42_BCL2L1-01        ---------------------------------
                                                         

© 1998-2021Legal notice