Dataset for protein Bcl-xL of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M3XA94_BCL2L1-02      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
M3XA94_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
M3XA94_BCL2L1-03      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSA
Q8SQ42_BCL2L1-01      MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSA
                      *************************.************************

M3XA94_BCL2L1-02      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
M3XA94_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
M3XA94_BCL2L1-03      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
Q8SQ42_BCL2L1-01      INGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELR
                      **************************************************

M3XA94_BCL2L1-02      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
M3XA94_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
M3XA94_BCL2L1-03      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q8SQ42_BCL2L1-01      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                      **************************************************

M3XA94_BCL2L1-02      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTF---------
M3XA94_BCL2L1-01      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWVVIEHQRCARLC
M3XA94_BCL2L1-03      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWVWT---------
Q8SQ42_BCL2L1-01      CVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTF---------
                      *****************:********************            

M3XA94_BCL2L1-02      ---VELYGNNAAAESRKGQVRTNAETELPQRVCPVLGTTPCLDFAGTGRD
M3XA94_BCL2L1-01      APQGAHSPEQSSPWSTSSRERRHDGQGNKQDCSGDKLFCNQLPQNLS---
M3XA94_BCL2L1-03      ---GLFYPEFLAQGLRLGK---------GLASICSMNMRLLLDAG-----
Q8SQ42_BCL2L1-01      ---VELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK-----
                              :  :     ..                      :        

M3XA94_BCL2L1-02      CWPGRWRKPPLGGSDHSAQLPSQGRSSRRRGRC
M3XA94_BCL2L1-01      ---------------------------------
M3XA94_BCL2L1-03      ---------------------------------
Q8SQ42_BCL2L1-01      ---------------------------------
                                                       

© 1998-2020Legal notice