Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------r-lv-d---ykl-q-g-----------------------------------------------------
mmatpataydn-e--v-yls---s-k-viglnlyvwsqfsdvegnrteaplgttsvpgtpssqpgrtswplrtsptlppa
 amagrssqythmiaqkfvkrvgrrrq      ln d     aedaga  e aepemeif ain nppahaad  lgng 
  h dcmgpsiaaalmgrihgraqipa       e                                             
  v e efgra l  a  ggfp kenh       c                                             
    a lrea  g  i   q g                                                          
      a a      g   m                                                            
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---gag--a------------lr-agdefe-r-------l--qlh-tpg-a---f-qvveelfrd-gvnwgrivaffafg
tpp---ls-gegvpqdpvhqa--e------p-yrrtfsd-ts---v---t-rqr-t-------eggip----------me
aghsssgpptsvpampalksvqnaveknlsrcfq dlaemsnfrvlsifsnytspntrmnkqh--p-iss almtivv-a
  c  apdkrgrilaavgfltmgqgsedtkt n  a erydlkhnivvdleqgigeaisgpggq av-pg  vlgtstl-
  a    g l pg stiavylnalekaqiql    v  mfaaepgph ea lypaapglddrap  ssga   i lgskt
  g    e    a gs egrg  c a a a          rg  ede  p erm r  fpa  g   ge    a g egd
               g  da                    l    a     aec q  a                     
                                        g              g                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g---alcves-----------vnkemeplv-------keisywmaeyltkrlgewirqn---ggwv--a---------s-
apqvi-ikklprgtyrkpkrglrerlavdlapvddtygr-a-fv--fintnted-lqssrll--peia-sqyqkskriei
-kpt-mapra           ypraiserivggvpdw--v-t--va--erh-atr-he-   yq-dlehikarvreme-y
tcimvg-a--           skvlrqt--reegrgvsqpqlrlttwa-d-vhppvedm   tak-gtetmtpgylvsld
saalt s-gr           qdl epswkgad   ddnlve  lf  p-sh--gp--h   e  qehclgsfemflkt 
d   s lgd            iea  rqp        ta ed  c   lm crs   r       kaf dff ce  dg 
    g  ea                 k g        p   s      kg a a   g       a d  a       a 
                                                a        a                      
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------e---e------------------------------q-ns-----------------------------------
flsmqd-iet-eiirdifqqgktnwgrivtlisfgcfipry-f--npppgnagpvimsieekmeadarsiyvgnvdygat
eaeklkvlqnvvvmlhvvseavs            gpvteksmsmshmdaeee       delyrqsle isrylreq  
ipnpdgkrslsrplaef rd sn            a ckkhlppitwlt                               
 k e   kpa l         e                adgelk gqes                               
                                        f k                                     
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------mve--lsspeevlslpktswsihq--------------
aeeleahfhgcgsvnrvtilcdkfsgdgvqrnhpkgfagmlryikplfagk--i---l-ld-n-frpgeeewgrqikvip
gtkdtkpmg s aas kaletlrrv        eta q    flt  vydsqs-rts-a--e-lspsvwtylwtkvtl s
                                          cqr  ptnqtdmklvtwvyylv-ar vin   ils   
                                          smd  ipanmreivrsrrmshmr-d ldg         
                                          l a  ak idc f grfqlhcgns              
                                          k     e e     fg  ia fkg              
                                                                g               
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------vre----eals-sgtdl-l--glg-a--------g---y-gylsr---------------------------
fgafvakhl-tffhvnrpgtg-lwrifpr---r-rtgnylss-sry-d-f---prqrvevgryrltlasweqilvqvpvd
        kv-    ----i-t---g-mparyfdkhtrrngrrkgflst-nklklghqyrkpataaplfkrsccilqntf
        -qs    lnveyaafrnselatmtvvlvsdkwvvkvvlwgalvghcsvedliqsqcrv cmlllvagvgvpv
        alq    sdq serwpfwsktpdvlrg kagdlidrttirseqpfqhr a e gi np  affhl ei agl
        fkn    ick rcisnav sknaswc    d   aqspalq mi f                ag        
         fd    f   q  n  d ril  t          fig  m fe                            
         a            i  a   f             c                                    
                      e                                                         

       490       
....:....|....:..
                 
-----------------
endmkvdevlyedssas
pltle            
lylsr            
af i             
                 
                 
                 
                 
© 1998-2021Legal notice