Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------l----l-ykl--------------------p-g--------s------------sp-g-ga---s--
mamtgrtsyynre-vvdy-s---sqkgynwsqlslyegnagla-l-ttsvsptg-llagrtsatart--t-s--tka-sv
  hadcmgqsihmiaqkfikevfglrrnevigfndvcegrtegagaggpspggprsiptnppwplqipqplpppsptirs
      efgddci im l h miapdvdaydei yfaadfiakne eearmeifwaqnhgqyqhkadggl nesaghgaa
        mt     k   p r      t k     v e  t  v awleqr alv  askkd  pre s ga ravlgy
                                            t  ai en         e    m  g a  g   et
                                                                              dg
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lqarsp--------------------------------------------------------------------------
----a-qttlapdslrvarpspigaegpdvtapssrllffaptrcasppegmeapaadaimspeeeldgyepeplgkrpa
gprl-v                                                                          
sddief                                                                          
 rgvgr                                                                          
 a g d                                                                          
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------p-rvveqtlrqagde
vlpllefvreassgpctdgslpstpppaeeeedelyrqsleiisrylreqatgtkdtkpmggsgvvqpk-klafkpvl-n
                                                                s-mnerhkn--em-rd
                                                                iasaah--- q-cqa-
                                                                g k--evtv ls-a q
                                                                e atpalsi  r   k
                                                                a  sn ie   g   g
                                                                       a   c    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  * :                  :                        
ferry-------------tp-targsfaqvmeelFrD-G-vnWGRivtffsfgGalivkslpeemqplv-----------
isv--rrafsemtsqlhi--gd-v----r-vnkq eqrhvt-----malia---ifckelvnsrnavdcrgyklelrewk
-qlnnetdladlsrk dvsif-d-trls-miahv s   iis   v--i-ele vmvarhqkriisesm           
vh-khq v qryr    lkrdahyqiantiardi q   kp     a -v- a t lp ypdktyrmpk           
l-tee     g l    gfne   kl e   qa  g              t   c  e a rns hk             
 dp                                                          fg                 
  i                                                                             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 :      *   : *                                                 
----d---riaywmaeylnrhlreWiqqngGW---------------------------------------f--------
agvd-tykelstfvttfitkntgt lrkqr eviahsqyqkskrisiflsmqdeieteeiirdifqqgktc-vplygpns
    sdiep-vlsiedv vdtkhp nvehy                           d talgt cyfvstliertqfqe
    r wpn le pcaw slrhed  id p                           q          enscqrpsesk 
      v -  d l  i kgp ts  eh                             k            l mkkf q  
           a           a   a                                          g  a   n  
                                                                      a         
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------dgfve----e-ls------vllagagf--k-------------------------
nhmdmvklaspepllslpktywniwqsgrafvtvaa--tgglrni-------sr-garlgrgkgyydtylkrclqhqevk
mwstgwtvtgmseiqqfrvssyrfh-p-k-emre-lvelpaidl-vmprlyvgkvsngveyqsrcrppcmllh leiq p
gflgfleih krgainslpqrsgsnr-vetplhwrdttdkdwqgrttlfslldgh rsaailiq   a  i         
          gncefl c gqean lws-knfstfs g a virfspvlqeqalq  e                      
           ma ae a   a   felldl glc      s dci i m mphf                         
           g   d         edec g            a     f   c                          
                         a                                                      

       490       500       510      
....:....|....:....|....:....|....:.
                                    
------------------------------------
pytlalafkeqicvqvpvdendmkvdevlyedssas
vlf se                     li lwtkl 
                                    
                                    
                                    
                                    
                                    
© 1998-2020Legal notice