Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------r-lv-d---yklsqkg------y---------g----ageg----------------------------
mmatpataydn-e--v-yls---r---viglnl-vwsqfsdvg-agge-p--pasvsgtpsdipgsvswpartsptlppa
 amagrssqythmiaqkfvmfvg-rra      lngdaglgaeenrtap-s atptprvmqaqafrtqahlad  lgng 
  h dcmgpsiaaalmgrikrgaqipq       e g     c dalss l tskemeiltsknvnppkrr         
  v e efgra l  a  ghgr kenh       c       a g ag  g reaat  fdtcimggaga          
    a lrea  g  i   g p                    p         gpl    ka a l               
      a a      g   q                                 lg                         
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------v---lr-agdefe-r--------------tp--a---f-qv-eelf-d-gvnwgrivaff-fg
tphssslparsvvpmpp-hqa--a------r-yrrtfsdltsqlhv--gt-rqr-t--v----r-g-p---------a--
agagaagd lepi  nalkltmkqclentsv fq dlaemsafrglsifseytspntrmnkqhegpi-ss avmtivvle
               dvgeknngpvsadlht n  a eryalepeihvda qgiaepisdpraq  viga  liglssga
               aeevyv aegk qiqp    v    rg   pe ep erp aa fpdg p   ge    a g e  
               t  grl  lea a al         l    d   l aem r  ag                 t  
               s  dag  c                               q                        
               g                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
g----lcves-----------vnkemeplv-------keisywmaeyltkrlgewirqn---ggwv--a---------s-
-pqta-----prgtyrkpkrglrerlavdlapvddtygr-a-fv--fintnted-lqssrll--peia-sqyqkskriei
a   imikkl           ypraiserivggvpdw--v-t--va--erh-atr-he-   yq-dlehikarvreme-y
s   v apra           skvlrqt--reegrgvsqpqlrlttwa-d-vhppvedm   tak-gtetmtpgylvsld
    t lag            qdl epswkgad   ddnlve  lf  p-sh--gp--h   e  qehclgsfemflkt 
       ed            iea  rqp        ta ed  c   lm crs   r       kaf dff ce  dg 
                          k g        p   s      kg a a   g       a d  a       a 
                                                a        a                      
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------e---e------------------------------q-ns-----------------------------------
flsmqd-iet-eiirdifqqgktnwgrivtlisfgcfipry-f--npppgnagpvimsieekmeadarsiyvgnvdygat
eaeklkvlqnvvvmlhvvseavs            gpvteksmsmshmdaeee       delyrqsle isrylreq  
ipnpdgkrslsrplaef rd sn            a ckkhlppitwlt                               
 k e   kpa l         e                adgelk gqes                               
                                        f k                                     
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------mve--lsspeevlslpktswsihq--------------
aeeleahfhgcgsvnrvtilcdkfsgdgvqrnhpkgfagmlryikplfagk--i---l-ld-n-frpgeeewgrqikvip
gtkdtkpmg s aas kaletlrrv        eta q    flt  vydsqs-rts-a--e-lspsvwtylwtkvtl s
                                          cqr  ptnqtdmklvtwvyylv-ar vin   ils   
                                          smd  ipanmreivrsrrmshmr-d ldg         
                                          l a  ak idc f grfqlhcgns              
                                          k     e e     fg  ia fkg              
                                                                g               
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------vre----eals-sgtdl-l--glg-a--------g---y-gylsr---------------------------
fgafvakhl-tffhvnrpgtg-lwrifpr---r-rtgnylss-sry-d-f---prqrvevgryrltlasweqilvqvpvd
        kv-    ----i-t---g-mparyfdkhtrrngrrkgflst-nklklghqyrkpataaplfkrsccilqntf
        -qs    lnveyaafrnselatmtvvlvsdkwvvkvvlwgalvghcsvedliqsqcrv cmlllvagvgvpv
        alq    sdq serwpfwsktpdvlrg kagdlidrttirseqpfqhr a e gi np  affhl ei agl
        fkn    ick rcisnav sknaswc    d   aqspalq mi f                ag        
         fd    f   q  n  d ril  t          fig  m fe                            
         a            i  a   f             c                                    
                      e                                                         

       490       
....:....|....:..
                 
-----------------
endmkvdevlyedssas
pltle            
lylsr            
af i             
                 
                 
                 
                 
© 1998-2022Legal notice