Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Sequences] [Repertoires]

23 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


F6ZPD4_BCL2L10-01         A-----------VAEA--LRERTALLLIDYLQRRARE-------------
F7AVA6_MCL1-01            ------------MFGLK------RNAVIGL---NLYCGGAGLGAGGGGAS
A0A5F5PK00_BCL2A1-02      ------------MTDC-EFGYI-HMLAQDYLKYVLQI-------------
A0A5F5PK00_BCL2A1-01      ------------MTDC-EFGYI-HMLAQDYLKYVLQI-------------
A0A5F5PK00_BCL2A1-04      ------------MTDC-EFGYI-HMLAQDYLKYVLQI-------------
A0A5F5PK00_BCL2A1-03      ------------MTDC-EFGYI-HMLAQDYLKYVLQI-------------
F6PH48_BCL2L2-01          MRLSSLTLTAARMATPA-SAPDTRALVADFVGYKLRQKGYVCG-------
F6PH48_BCL2L2-02          ------------MATPA-SAPDTRALVADFVGYKLRQKGYVCG-------
F6PH48_BCL2L2-03          ------------MAAAA-AAAAAAGAAGGRGSGPGRRRHLVPG-------
A0A3Q2HRY3_BCL2-01        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-08        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-10        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-06        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-09        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-03        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-04        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2H0F6_BCL2L1-02      ------------MSQ------SNRELVVDFLSYKLSQKGYNWSQ------
A0A3Q2H0F6_BCL2L1-03      ------------MSQ------SNRELVVDFLSYKLSQKGYNWSQ------
A0A3Q2H0F6_BCL2L1-01      ------------MSQ------SNRELVVDFLSYKLSQKGYNWSQ------
A0A3Q2H0F6_BCL2L1-04      ------------MSQ------SNRELVVDFLSYKLSQKGYNWSQ------
A0A3Q2HRY3_BCL2-05        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-07        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
A0A3Q2HRY3_BCL2-02        ------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAA
                                      :                                     

F6ZPD4_BCL2L10-01         -----------------------P--------------------------
F7AVA6_MCL1-01            SPGGRLLAAGKEAGAVIGGSAG-GSPQTTLAPDSL---RVARPSPIGAEG
A0A5F5PK00_BCL2A1-02      -----------------------PQPGS--GPSKT-SRVLQDIAF-----
A0A5F5PK00_BCL2A1-01      -----------------------PQPGS--GPSKT-SRVLQDIAF-----
A0A5F5PK00_BCL2A1-04      -----------------------PQPGS--GPSKT-SRVLQDIAF-----
A0A5F5PK00_BCL2A1-03      -----------------------PQPGS--GPSKT-SRVLQDIAF-----
F6PH48_BCL2L2-01          ------------------------------------------------AG
F6PH48_BCL2L2-02          ------------------------------------------------AG
F6PH48_BCL2L2-03          ------------------------------------------------AG
A0A3Q2HRY3_BCL2-01        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-08        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-10        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-06        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-09        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-03        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-04        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2H0F6_BCL2L1-02      --------------------FSDVEENRTEAPEGTESEMETPSAINGNPS
A0A3Q2H0F6_BCL2L1-03      --------------------FSDVEENRTEAPEGTESEMETPSAINGNPS
A0A3Q2H0F6_BCL2L1-01      --------------------FSDVEENRTEAPEGTESEMETPSAINGNPS
A0A3Q2H0F6_BCL2L1-04      --------------------FSDVEENRTEAPEGTESEMETPSAINGNPS
A0A3Q2HRY3_BCL2-05        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-07        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
A0A3Q2HRY3_BCL2-02        PLGAT----------PVPGIFS-SQPGRTPAPART-SPLLPPAAPAGAAG
                                                                            

F6ZPD4_BCL2L10-01         -A------------------------------------------------
F7AVA6_MCL1-01            PDVTAPSSRLLFFAPTRCASPPEGMEAPAADAIMSPEEELDGYEPEPLGK
A0A5F5PK00_BCL2A1-02      --------------------------------------------------
A0A5F5PK00_BCL2A1-01      --------------------------------------------------
A0A5F5PK00_BCL2A1-04      --------------------------------------------------
A0A5F5PK00_BCL2A1-03      --------------------------------------------------
F6PH48_BCL2L2-01          PGEG---------------------PAA----------------------
F6PH48_BCL2L2-02          PGEG---------------------PAA----------------------
F6PH48_BCL2L2-03          GEAG---------------------EGA----------------------
A0A3Q2HRY3_BCL2-01        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-08        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-10        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-06        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-09        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-03        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-04        PALS---------------------PVP----------------------
A0A3Q2H0F6_BCL2L1-02      WHLA---------------------DSPTGNGATGHSSSLDAREVIPM--
A0A3Q2H0F6_BCL2L1-03      WHLA---------------------DSPTGNGATGHSSSLDAREVIPM--
A0A3Q2H0F6_BCL2L1-01      WHLA---------------------DSPTGNGATGHSSSLDAREVIPM--
A0A3Q2H0F6_BCL2L1-04      WHLA---------------------DSPTGNGATGHSSSLDAREVIPM--
A0A3Q2HRY3_BCL2-05        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-07        PALS---------------------PVP----------------------
A0A3Q2HRY3_BCL2-02        PALS---------------------PVP----------------------
                                                                            

F6ZPD4_BCL2L10-01         --------------------------------------------------
F7AVA6_MCL1-01            RPAVLPLLEFVREASSGPCTDGSLPSTPPPAEEEEDELYRQSLEIISRYL
A0A5F5PK00_BCL2A1-02      --------------------------------------------------
A0A5F5PK00_BCL2A1-01      --------------------------------------------------
A0A5F5PK00_BCL2A1-04      --------------------------------------------------
A0A5F5PK00_BCL2A1-03      --------------------------------------------------
F6PH48_BCL2L2-01          --------------------------------------------------
F6PH48_BCL2L2-02          --------------------------------------------------
F6PH48_BCL2L2-03          --------------------------------------------------
A0A3Q2HRY3_BCL2-01        --------------------------------------------------
A0A3Q2HRY3_BCL2-08        --------------------------------------------------
A0A3Q2HRY3_BCL2-10        --------------------------------------------------
A0A3Q2HRY3_BCL2-06        --------------------------------------------------
A0A3Q2HRY3_BCL2-09        --------------------------------------------------
A0A3Q2HRY3_BCL2-03        --------------------------------------------------
A0A3Q2HRY3_BCL2-04        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-02      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-03      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-01      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-04      --------------------------------------------------
A0A3Q2HRY3_BCL2-05        --------------------------------------------------
A0A3Q2HRY3_BCL2-07        --------------------------------------------------
A0A3Q2HRY3_BCL2-02        --------------------------------------------------
                                                                            

F6ZPD4_BCL2L10-01         --------------------TPEVAVLRCVAAQIQ---------------
F7AVA6_MCL1-01            REQATGTKDTKPMGGSGAASRKALETLRRVGDGVQ---------------
A0A5F5PK00_BCL2A1-02      --------------------------------SVQ---------------
A0A5F5PK00_BCL2A1-01      --------------------------------SVQ---------------
A0A5F5PK00_BCL2A1-04      --------------------------------SVQ---------------
A0A5F5PK00_BCL2A1-03      --------------------------------SVQ---------------
F6PH48_BCL2L2-01          --------------------DPLHQAMRAAGDEFE---------------
F6PH48_BCL2L2-02          --------------------DPLHQAMRAAGDEFE---------------
F6PH48_BCL2L2-03          ---------------------PGGAGDYGNGLESEELEPEELLLEPEPEP
A0A3Q2HRY3_BCL2-01        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-08        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-10        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-06        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-09        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-03        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-04        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2H0F6_BCL2L1-02      --------------------AAVKQALREAGDEFE---------------
A0A3Q2H0F6_BCL2L1-03      --------------------AAVKQALREAGDEFE---------------
A0A3Q2H0F6_BCL2L1-01      --------------------AAVKQALREAGDEFE---------------
A0A3Q2H0F6_BCL2L1-04      --------------------AAVKQALREAGDEFE---------------
A0A3Q2HRY3_BCL2-05        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-07        --------------------PVVHLTLRQAGDDFS---------------
A0A3Q2HRY3_BCL2-02        --------------------PVVHLTLRQAGDDFS---------------
                                                            .               

F6ZPD4_BCL2L10-01         ---PRNQRVLSRYRGFRGDHV-G----LAA--RMAQAIFGDRHVPSWGRV
F7AVA6_MCL1-01            ---RNHETAFQGMLRKLDIKN-EDDVKSLS--RVMAHVFSDG-VTNWGRI
A0A5F5PK00_BCL2A1-02      ---NEVEKNLKPCLDNFHVVSIDAARTIFN--QVMEKQFEDG-IINWGRI
A0A5F5PK00_BCL2A1-01      ---NEVEKNLKPCLDNFHVVSIDAARTIFN--QVMEKQFEDG-IINWGRI
A0A5F5PK00_BCL2A1-04      ---NEVEKNLKPCLDNFHVVSIDAARTIFN--QVMEKQFEDG-IINWGRI
A0A5F5PK00_BCL2A1-03      ---NEVEKNLKPCLDNFHVVSIDAARTIFN--QVMEKQFEDG-IINWGRI
F6PH48_BCL2L2-01          ---TRFRRTFSDLAAQLHVTP-GSAQQRFT--QVSDELFQGG--PNWGRL
F6PH48_BCL2L2-02          ---TRFRRTFSDLAAQLHVTP-GSAQQRFT--QVSDELFQGG--PNWGRL
F6PH48_BCL2L2-03          EPEEEPPRPRAPPGA-PGPGP-GSGAPGSQEEEEEPGLVEGD--PGDGAI
A0A3Q2HRY3_BCL2-01        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-08        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-10        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-06        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-09        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-03        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-04        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2H0F6_BCL2L1-02      ---LRYRRAFSDLTSQLHITP-GTAYQSFE--QVVNELFRDG--VNWGRI
A0A3Q2H0F6_BCL2L1-03      ---LRYRRAFSDLTSQLHITP-GTAYQSFE--QVVNELFRDG--VNWGRI
A0A3Q2H0F6_BCL2L1-01      ---LRYRRAFSDLTSQLHITP-GTAYQSFE--QVVNELFRDG--VNWGRI
A0A3Q2H0F6_BCL2L1-04      ---LRYRRAFSDLTSQLHITP-GTAYQSFE--QVVNELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-05        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-07        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
A0A3Q2HRY3_BCL2-02        ---RRYRRDFAEMSSQLHLTP-FTARGRFA--TVVEELFRDG--VNWGRI
                              .                                 . .    . * :

F6ZPD4_BCL2L10-01         AALVTLAGTLLE--RAPRGTYRKPKRGYKLELREWKAGVDRDWPRLVD--
F7AVA6_MCL1-01            VTLISFGAFVAKHLK----------------------SINQE--SCIE--
A0A5F5PK00_BCL2A1-02      MTIFAFEGILIK--K----------------------LLPERIAPDVDTY
A0A5F5PK00_BCL2A1-01      MTIFAFEGILIK--K----------------------LLPERIAPDVDTY
A0A5F5PK00_BCL2A1-04      MTIFAFEGILIK--K----------------------LLPERIAPDVDTY
A0A5F5PK00_BCL2A1-03      MTIFAFEGILIK--K----------------------LLPERIAPDVDTY
F6PH48_BCL2L2-01          VAFFVFGAALCA--E----------------------SVNKEMEPLVG--
F6PH48_BCL2L2-02          VAFFVFGAALCA--E----------------------SVNKEMEPLVG--
F6PH48_BCL2L2-03          --------------------------------------------------
A0A3Q2HRY3_BCL2-01        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-08        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-10        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-06        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-09        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-03        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-04        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2H0F6_BCL2L1-02      VAFFSFGGALCV--E----------------------SVDKEMQVLVS--
A0A3Q2H0F6_BCL2L1-03      VAFFSFGGALCV--E----------------------SVDKEMQVLVS--
A0A3Q2H0F6_BCL2L1-01      VAFFSFGGALCV--E----------------------SVDKEMQVLVS--
A0A3Q2H0F6_BCL2L1-04      VAFFSFGGALCV--E----------------------SVDKEMQVLVS--
A0A3Q2HRY3_BCL2-05        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-07        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
A0A3Q2HRY3_BCL2-02        VAFFEFGGVMCV--E----------------------SVNREMSPLVD--
                                                                            

F6ZPD4_BCL2L10-01         -FLCAW----LKGRHRAWLEAHYGWDGFCDFS------LTLP-AS-Q---
F7AVA6_MCL1-01            -PLAESITDVLVRTKRDWLVKQRGWDGFVEFF------HVED-LE-G---
A0A5F5PK00_BCL2A1-02      KEISYFVAEFITKNTGEWIRQNGGWPRVHWL-------------------
A0A5F5PK00_BCL2A1-01      KEISYFVAEFITKNTGEWIRQNGGWAFLCNDR-----------AY-----
A0A5F5PK00_BCL2A1-04      KEISYFVAEFITKNTGEWIRQNGGWHFLLIAW------CCPDLLLPFPSL
A0A5F5PK00_BCL2A1-03      KEISYFVAEFITKNTGEWIRQNGGWENGFVKK------FEPK-SG-----
F6PH48_BCL2L2-01          -QVQEWMVAYLETRLADWIHSSGGWAEFTALYG----DGAL--EE-AR--
F6PH48_BCL2L2-02          -QVQEWMVAYLETRLADWIHSSGGW-ELEAIKARV--REME--EE-AEKL
F6PH48_BCL2L2-03          ----------------------EDP-ELEAIKARV--REME--EE-AEKL
A0A3Q2HRY3_BCL2-01        -NIALWMTEYLNRHLHTWIQDNGGWVGSLGSW------ECGS-NQ-G---
A0A3Q2HRY3_BCL2-08        -NIALWMTEYLNRHLHTWIQDNGGWVTDGKTR------KAVS-FS-E-T-
A0A3Q2HRY3_BCL2-10        -NIALWMTEYLNRHLHTWIQDNGGWQLCQAPTG-S--QEMFS-VG-F---
A0A3Q2HRY3_BCL2-06        -NIALWMTEYLNRHLHTWIQDNGGWFSIAIYR------HPMQ-NQ-----
A0A3Q2HRY3_BCL2-09        -NIALWMTEYLNRHLHTWIQDNGGWDAFVELYG-PSMRPLFD-FS-W-L-
A0A3Q2HRY3_BCL2-03        -NIALWMTEYLNRHLHTWIQDNGGWKQDIVFA------ENLE-NR-E---
A0A3Q2HRY3_BCL2-04        -NIALWMTEYLNRHLHTWIQDNGGWQLCQAPTG-S--QEMFS-GG-W-TI
A0A3Q2H0F6_BCL2L1-02      -RIATWMATYLNDHLEPWIQENGGWKETALGT-----FCYFV-SS-L-M-
A0A3Q2H0F6_BCL2L1-03      -RIATWMATYLNDHLEPWIQENGGWVHVLWSQ------TPSL-SN-W-T-
A0A3Q2H0F6_BCL2L1-01      -RIATWMATYLNDHLEPWIQENGGWVRTT---------------------
A0A3Q2H0F6_BCL2L1-04      -RIATWMATYLNDHLEPWIQENGGWDTFV---------------------
A0A3Q2HRY3_BCL2-05        -NIALWMTEYLNRHLHTWIQDNGGWQLCQAPTG-S--QEMFS-GG-W-TI
A0A3Q2HRY3_BCL2-07        -NIALWMTEYLNRHLHTWIQDNGGWVGEAK--------------------
A0A3Q2HRY3_BCL2-02        -NIALWMTEYLNRHLHTWIQDNGGWAP-----------------------
                                                 .                          

F6ZPD4_BCL2L10-01         --------------------------------------------------
F7AVA6_MCL1-01            --------------------------------------------------
A0A5F5PK00_BCL2A1-02      ---GSWVRTY----------------------------------------
A0A5F5PK00_BCL2A1-01      ---GTTCPSQ----------------------------------------
A0A5F5PK00_BCL2A1-04      SQVETVCESQLGETGFPTDGVGL--------QQPG---------------
A0A5F5PK00_BCL2A1-03      ---WLTFLEV----------------------------------------
F6PH48_BCL2L2-01          --------------------------------------------------
F6PH48_BCL2L2-02          KELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAE
F6PH48_BCL2L2-03          KELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAE
A0A3Q2HRY3_BCL2-01        --------------------------------------------------
A0A3Q2HRY3_BCL2-08        --------------------------------------------------
A0A3Q2HRY3_BCL2-10        --------------------------------------------------
A0A3Q2HRY3_BCL2-06        --------------------------------------------------
A0A3Q2HRY3_BCL2-09        --------------------------------------------------
A0A3Q2HRY3_BCL2-03        --------------------------------------------------
A0A3Q2HRY3_BCL2-04        H-------------------------------------------------
A0A3Q2H0F6_BCL2L1-02      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-03      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-01      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-04      --------------------------------------------------
A0A3Q2HRY3_BCL2-05        H-------------------------------------------------
A0A3Q2HRY3_BCL2-07        --------------------------------------------------
A0A3Q2HRY3_BCL2-02        --------------------------------------------------
                                                                            

F6ZPD4_BCL2L10-01         --------------------------------------------------
F7AVA6_MCL1-01            ----------------GIRN------------------------------
A0A5F5PK00_BCL2A1-02      ------------T---PLIK-----------------------PCCGGI-
A0A5F5PK00_BCL2A1-01      ------------S---------------------------------PFL-
A0A5F5PK00_BCL2A1-04      ----------T-Q---ILLQ-----------------------TLCHSPS
A0A5F5PK00_BCL2A1-03      ------------T---------------------------------GKM-
F6PH48_BCL2L2-01          --------------------------------------------------
F6PH48_BCL2L2-02          ELEAHFHGCGSVNRVTILCD---KFSGHPKGFAYIEFSDKESVRTSLALD
F6PH48_BCL2L2-03          ELEAHFHGCGSVNRVTILCD---KFSGHPKGFAYIEFSDKESVRTSLALD
A0A3Q2HRY3_BCL2-01        --------------------------------------------------
A0A3Q2HRY3_BCL2-08        ----------------PLWN------------------------------
A0A3Q2HRY3_BCL2-10        --------------------------------------------------
A0A3Q2HRY3_BCL2-06        --------------------------------------------------
A0A3Q2HRY3_BCL2-09        ----------------SLKA------------------------------
A0A3Q2HRY3_BCL2-03        --------------------------------------------------
A0A3Q2HRY3_BCL2-04        ----------SGS---PLQNLCVSR-------AGNWFSEKKNMTWCLTSD
A0A3Q2H0F6_BCL2L1-02      ----------------RLSG-----------------------QG-----
A0A3Q2H0F6_BCL2L1-03      ----------------PLWN-----------------------ST-----
A0A3Q2H0F6_BCL2L1-01      ----------------PLVY-----------------------SF-----
A0A3Q2H0F6_BCL2L1-04      ----------------ELYG-----------------------NN-----
A0A3Q2HRY3_BCL2-05        ----------SGS---PLQNLCVSR-------AGK---------------
A0A3Q2HRY3_BCL2-07        --------------------------------------------------
A0A3Q2HRY3_BCL2-02        --------------------------------------------------
                                                                            

F6ZPD4_BCL2L10-01         --------------R------ILLV--------RF------------LL-
F7AVA6_MCL1-01            -----------------------------------------------VLL
A0A5F5PK00_BCL2A1-02      --------------------------------------------------
A0A5F5PK00_BCL2A1-01      --------------------------------------------------
A0A5F5PK00_BCL2A1-04      RLECELDLVTCFQRRE--------------------CRKGKQSNSAVEK-
A0A5F5PK00_BCL2A1-03      --------------------------------------------------
F6PH48_BCL2L2-01          ---------------------------------R--LREGNWASVRTVL-
F6PH48_BCL2L2-02          ESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYR--ARTTNYNSSRSRF-
F6PH48_BCL2L2-03          ESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYR--ARTTNYNSSRSRF-
A0A3Q2HRY3_BCL2-01        --------------QR-----LQMS--------HCQ--------------
A0A3Q2HRY3_BCL2-08        -----------------------------------------------CT-
A0A3Q2HRY3_BCL2-10        --------------------------------------------------
A0A3Q2HRY3_BCL2-06        --------------------------------------------------
A0A3Q2HRY3_BCL2-09        -----------------------------------------------LL-
A0A3Q2HRY3_BCL2-03        --------------K-----------------------------------
A0A3Q2HRY3_BCL2-04        KDVIDRTPIRMYQGRK-----SREA--------EIQSQCRPPCM---LL-
A0A3Q2H0F6_BCL2L1-02      --------------GA-----LQLA--------P--SYSAFWAD---SR-
A0A3Q2H0F6_BCL2L1-03      --------------GT-----T--------------------------R-
A0A3Q2H0F6_BCL2L1-01      --------------CL-----ASGQ--------R----------------
A0A3Q2H0F6_BCL2L1-04      --------------AA-----AESR--------K--GQERFNRW---FL-
A0A3Q2HRY3_BCL2-05        --------------------------------------------------
A0A3Q2HRY3_BCL2-07        --------------------------------------------------
A0A3Q2HRY3_BCL2-02        --------------------------------------------------
                                                                            

F6ZPD4_BCL2L10-01         SC---F-SASVLIYLW----------TKLS
F7AVA6_MCL1-01            AFAG-VAG--VGAGLA----------YLIR
A0A5F5PK00_BCL2A1-02      ----------SRRRTR----------RTCN
A0A5F5PK00_BCL2A1-01      ----------PETLFS---------NSAFL
A0A5F5PK00_BCL2A1-04      PGKYYF----GKVIKV----------NIIS
A0A5F5PK00_BCL2A1-03      ----------CEILFL----------KQYY
F6PH48_BCL2L2-01          TGAVAL-GALVTVGAF----------FASK
F6PH48_BCL2L2-02          YSGFNS----RPRGRVYRGRARATSWYSPY
F6PH48_BCL2L2-03          YSGFNS----RPRGRV----------YRSG
A0A3Q2HRY3_BCL2-01        ------------LNGN----------QCCL
A0A3Q2HRY3_BCL2-08        APA--C-GR---CLIS----------PGCL
A0A3Q2HRY3_BCL2-10        ---------------Q----------RRKI
A0A3Q2HRY3_BCL2-06        --------------------------WKCR
A0A3Q2HRY3_BCL2-09        SLAL-V-GACITLGAY----------LGHK
A0A3Q2HRY3_BCL2-03        ---------------R----------KRKK
A0A3Q2HRY3_BCL2-04        HLLE-I-QVPVLFLIF----------DRYL
A0A3Q2H0F6_BCL2L1-02      APLG-TRGF-SLALQE----------MPLQ
A0A3Q2H0F6_BCL2L1-03      QPKA---GR-A-RSAS----------TAGS
A0A3Q2H0F6_BCL2L1-01      ------------GSPT----------VSTL
A0A3Q2H0F6_BCL2L1-04      TGMT-VAGV-VLLGSL----------FSRK
A0A3Q2HRY3_BCL2-05        ------------------------------
A0A3Q2HRY3_BCL2-07        ----------------------------CG
A0A3Q2HRY3_BCL2-02        ------------------------------
                                                        

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice