Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F5Q151_MCL1-02      -------------------MFGLKRNAVIGLNLYCGGAGLGAGGGGASSP
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
F6ZPD4_BCL2L10-01       -AVAEALRERTALLLIDYLQRRAREPA-----------------------
A0A5F5PK00_BCL2A1-      --MTDCEFGYIHMLAQDYLKYVLQIPQ---------------------PG
A0A5F5PK00_BCL2A1-      --MTDCEFGYIHMLAQDYLKYVLQIPQ---------------------PG
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKG------YNWSQFSDVEENRTEAP
A0A3Q2H0F6_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKG------YNWSQFSDVEENRTEAP
A0A3Q2HRY3_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRG------YEWD-----AGDAGAAP
A0A3Q2HRY3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRG------YEWD-----AGDAGAAP
A0A5F5Q151_MCL1-01      -------------------MFGLKRNAVIGLNLYC-------GGAGLGAG
A0A5F5PML6_BCL2L2-      -MAAAAAAAAAAGAAGGRGSGPGRRRH------LV-------PGAGGEAG
A0A5F5PML6_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YV-------CGAG--PG
A0A5F5PML6_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------YV-------CGAG--PG
                                                                          

A0A5F5Q151_MCL1-02      GGRLLATGTKDTKPMGGSGAA-----------------------------
A0A5F5PK00_BCL2A1-      ---------MTDCIL-----------------------------------
A0A5F5PK00_BCL2A1-      ---------MAAAAVSGAKRR-----------------------------
F6ZPD4_BCL2L10-01       ---------------------------------------------TPEVA
A0A5F5PK00_BCL2A1-      SGPSKTSRVLQDIAFSVQ---------------------------NEVEK
A0A5F5PK00_BCL2A1-      SGPSKTSRVLQDIAFSVQ---------------------------NEVEK
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      EGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREVIPMAAVKQ
A0A3Q2H0F6_BCL2L1-      EGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREVIPMAAVKQ
A0A3Q2HRY3_BCL2-02      LGATPVPGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALSPVP-PVVHL
A0A3Q2HRY3_BCL2-01      LGATPVPGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALSPVP-PVVHL
A0A5F5Q151_MCL1-01      GGGAS----------------------------------------SPGGR
A0A5F5PML6_BCL2L2-      EGAPG----------------------------------------GAGDY
A0A5F5PML6_BCL2L2-      EGPAA----------------------------------------DPLHQ
A0A5F5PML6_BCL2L2-      EGPAA----------------------------------------DPLHQ
                                                                          

A0A5F5Q151_MCL1-02      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
F6ZPD4_BCL2L10-01       VLRCVAAQIQPRNQRVLSRYRGFRGDHVGLAARMAQAIFGDRH---VPSW
A0A5F5PK00_BCL2A1-      NLKPCLDNFHV--------------VSIDAARTIFNQVMEKQFEDGIINW
A0A5F5PK00_BCL2A1-      NLKPCLDNFHV--------------VSIDAARTIFNQVMEKQFEDGIINW
A0A5F5PK00_BCL2A1-      --------------------------------------MEKQFEDGIINW
A0A3Q2H0F6_BCL2L1-      ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRD-GVNW
A0A3Q2H0F6_BCL2L1-      ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRD-GVNW
A0A3Q2HRY3_BCL2-02      TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD-GVNW
A0A3Q2HRY3_BCL2-01      TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD-GVNW
A0A5F5Q151_MCL1-01      LLAAGKEATARR-------------------------------EGGGGEA
A0A5F5PML6_BCL2L2-      GNGLESEELEP------EELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGS
A0A5F5PML6_BCL2L2-      AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNW
A0A5F5PML6_BCL2L2-      AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQG-GPNW
                                                                          

A0A5F5Q151_MCL1-02      -------------------------------SRKALET------------
A0A5F5PK00_BCL2A1-      -------------------------------IKKLLPERIAPDVDTYKEI
A0A5F5PK00_BCL2A1-      -------------------------------LRAELKQRLR---------
F6ZPD4_BCL2L10-01       GRVAALVTLAG---TLLERAPRGTYRKPKRGYKLELREWKAGVDRDWPRL
A0A5F5PK00_BCL2A1-      GRIMTIFAFEG---ILIKKL-----------LPERIAPDV----DTYKEI
A0A5F5PK00_BCL2A1-      GRIMTIFAFEG---ILIKKL-----------LPERIAPDV----DTYKEI
A0A5F5PK00_BCL2A1-      GRIMTIFAFEG---ILIKKL-----------LPERIAPDV----DTYKEI
A0A3Q2H0F6_BCL2L1-      GRIVAFFSFGG---ALCVES-----------VDKEMQVLV-------SRI
A0A3Q2H0F6_BCL2L1-      GRIVAFFSFGG---ALCVES-----------VDKEMQVLV-------SRI
A0A3Q2HRY3_BCL2-02      GRIVAFFEFGG---VMCVES-----------VNREMSPLV-------DNI
A0A3Q2HRY3_BCL2-01      GRIVAFFEFGG---VMCVES-----------VNREMSPLV-------DNI
A0A5F5Q151_MCL1-01      GAVIGGSAGGSPQTTLAPDS-----------LRVARPSPIGAEGPDVTAP
A0A5F5PML6_BCL2L2-      G---------------APGS-----------QEEEEEPGLVEGDPGDGAI
A0A5F5PML6_BCL2L2-      GRLVAFFVFGA---ALCAES-----------VNKEMEPLV-------GQV
A0A5F5PML6_BCL2L2-      GRLVAFFVFGA---ALCAES-----------VNKEMEPLV-------GQV
                                                                          

A0A5F5Q151_MCL1-02      --------LRRVGDGVQRN--------HETAFQGMLRKLDIKNEDDVKSL
A0A5F5PK00_BCL2A1-      SYFVAEFITKNTGEWIRQN---GGWVIAHSQYQKSKRISIFLSMQDEIET
A0A5F5PK00_BCL2A1-      --------AMSAEERLRQSRLLTQKVIAHSQYQKSKRISIFLSMQDEIET
F6ZPD4_BCL2L10-01       VDFLCAWLKGRHRAWLEAH---YGWDGFCDF-------------------
A0A5F5PK00_BCL2A1-      SYFVAEFITKNTGEWIRQN---GGW-------------------------
A0A5F5PK00_BCL2A1-      SYFVAEFITKNTGEWIRQN---GGWVIAHSQYQKSKRISIFLSMQDEIET
A0A5F5PK00_BCL2A1-      SYFVAEFITKNTGEWIRQN---GGWVIAHSQYQKSKRISIFLSMQDEIET
A0A3Q2H0F6_BCL2L1-      ATWMATYLNDHLEPWIQEN---GGWD------------T-----------
A0A3Q2H0F6_BCL2L1-      ATWMATYLNDHLEPWIQEN---GGWKETALGTFCYFVSS-----------
A0A3Q2HRY3_BCL2-02      ALWMTEYLNRHLHTWIQDN---GGWQ------------L-----------
A0A3Q2HRY3_BCL2-01      ALWMTEYLNRHLHTWIQDN---GGWD------------A-----------
A0A5F5Q151_MCL1-01      SSRLLFFAPTRCASPPEGM---EAPAADAIMSPEEELDGYEPEPLGKRPA
A0A5F5PML6_BCL2L2-      ED----------------------PELEAIKARVREMEE-EAEKLKELQN
A0A5F5PML6_BCL2L2-      QEWMVAYLETRLADWIHSS---GGWELEAIKARVREMEE-EAEKLKELQN
A0A5F5PML6_BCL2L2-      QEWMVAYLETRLADWIHSS---GGWELEAIKARVREMEE-EAEKLKELQN
                                                                          

A0A5F5Q151_MCL1-02      SRVMAHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQES-----------
A0A5F5PK00_BCL2A1-      EEIIRDIFQQGKT------------CFIPRYQFNSNHMD-----------
A0A5F5PK00_BCL2A1-      EEIIRDIFQQGKT------------CFIPRYQFNSNHMD-----------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A5F5PK00_BCL2A1-      -----------EN------------GFVKKFEPKSGWLT-----------
A0A5F5PK00_BCL2A1-      EEIIRDIFQQGKT------------CFIPRYQFNSNHMD-----------
A0A5F5PK00_BCL2A1-      EEIIRDIFQQGKT------------CFIPRYQFNSNHMD-----------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A5F5Q151_MCL1-01      VLPLLEFVREASS------------GPCTDGSLPSTPPPAEEE------E
A0A5F5PML6_BCL2L2-      EV---------------------------EKQMNMSPPPGNAGPVIMSIE
A0A5F5PML6_BCL2L2-      EV---------------------------EKQMNMSPPPGNAGPVIMSIE
A0A5F5PML6_BCL2L2-      EV---------------------------EKQMNMSPPPGNAGPVIMSIE
                                                                          

A0A5F5Q151_MCL1-02      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A5F5Q151_MCL1-01      DELYRQSLEIISRYLREQATGTKDTKPMGGSGAASRKALETLRRVGDGVQ
A0A5F5PML6_BCL2L2-      EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG----
A0A5F5PML6_BCL2L2-      EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG----
A0A5F5PML6_BCL2L2-      EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSG----
                                                                          

A0A5F5Q151_MCL1-02      ------------CIEPLAESITDVLVRTKRDWLVKQRGWDG---------
A0A5F5PK00_BCL2A1-      ------------MVK--LASPEEILSLPKTSWNIHQPGEEE---------
A0A5F5PK00_BCL2A1-      ------------MVK--LASPEEILSLPKTSWNIHQPGEEE---------
F6ZPD4_BCL2L10-01       ------------SLT--LPASQRILLVRFLLSCFSASVLIYLWTKLS---
A0A5F5PK00_BCL2A1-      ------------FLE--VTGKMCEILFLKQYY------------------
A0A5F5PK00_BCL2A1-      ------------MVK--LASPEEILSLPKTSWNIHQPGEEE---------
A0A5F5PK00_BCL2A1-      ------------MVK--LASPEEILSLPKTSWNIHQPGEEE---------
A0A3Q2H0F6_BCL2L1-      ------------FVE--LYGN-------------NA--------------
A0A3Q2H0F6_BCL2L1-      ------------LMR--LSGQ-------------GG--------------
A0A3Q2HRY3_BCL2-02      ------------CQA--PTGSQEMFSGGWTIHSGSP--------------
A0A3Q2HRY3_BCL2-01      ------------FVE--LYGP-----------SMRP--------------
A0A5F5Q151_MCL1-01      RNHETAFQGMLRKLD--IKNEDDVKSLSRVMAHVFSDGVTNWGRIVTLIS
A0A5F5PML6_BCL2L2-      --HPKGFA----YIE--FSDKESVRTSLALDESLFR------GRQIKVIP
A0A5F5PML6_BCL2L2-      --HPKGFA----YIE--FSDKESVRTSLALDESLFR------GRQIKVIP
A0A5F5PML6_BCL2L2-      --HPKGFA----YIE--FSDKESVRTSLALDESLFR------GRQIKVIP
                                                                          

A0A5F5Q151_MCL1-02      --------FVEFFHVEDLE-GGIRNVLLAFAGVAGVGAGL--------AY
A0A5F5PK00_BCL2A1-      --------VRE----EALSTGGLDLILMPGLGFDKHGNRLGRGKGYYDTY
A0A5F5PK00_BCL2A1-      --------VRE----EALSTGGLDLILMPGLGFDKHGNRLGRGKGYYDTY
F6ZPD4_BCL2L10-01       --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      --------VRE----EALSTAAWR--------------------------
A0A5F5PK00_BCL2A1-      --------VRE----EALSTGGLDLILMPGLGFDKHGNRLGRGKGYYDTY
A0A3Q2H0F6_BCL2L1-      --------AAE----SRKGQERFNRWFLTGMTVA--------GVVLLGSL
A0A3Q2H0F6_BCL2L1-      --------ALQ----LAPSYSAFWADSRAPLGTR--------GFSLALQE
A0A3Q2HRY3_BCL2-02      --------LQN----LCVSRAGNWFSEKKNMTWCLTSDKDVIDRTPIRMY
A0A3Q2HRY3_BCL2-01      --------LFD----F------SWLSLKALLSLALVG-----ACITLGAY
A0A5F5Q151_MCL1-01      FGAFVAKHLKS----INQESCIEPLAESITDVLVRTKRDWLVKQRGWDGF
A0A5F5PML6_BCL2L2-      --------KRT----NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGF
A0A5F5PML6_BCL2L2-      --------KRT----NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGF
A0A5F5PML6_BCL2L2-      --------KRT----NRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGF
                                                                          

A0A5F5Q151_MCL1-02      LIR--------------------------------------------
A0A5F5PK00_BCL2A1-      LKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYEDSSAS
A0A5F5PK00_BCL2A1-      LKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYEDSSAS
F6ZPD4_BCL2L10-01       -----------------------------------------------
A0A5F5PK00_BCL2A1-      -----------------------------------------------
A0A5F5PK00_BCL2A1-      -----------------------------------------------
A0A5F5PK00_BCL2A1-      LKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVLYEDSSAS
A0A3Q2H0F6_BCL2L1-      FSRK-------------------------------------------
A0A3Q2H0F6_BCL2L1-      MPLQ-------------------------------------------
A0A3Q2HRY3_BCL2-02      QGRKSREAEIQSQCRPPCMLLHLLEIQVPVLFLSE------------
A0A3Q2HRY3_BCL2-01      LGHK-------------------------------------------
A0A5F5Q151_MCL1-01      VEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR------------
A0A5F5PML6_BCL2L2-      NSRPRGRVYRGRARAT--SWRSCLILVNTFPLTLE------------
A0A5F5PML6_BCL2L2-      NSRPRGRVYRGRARAT--SWFL-------------------------
A0A5F5PML6_BCL2L2-      NSRPRGRVYRGRARAT--SWRSCLILVNTFPLTLE------------
                                                                       

© 1998-2022Legal notice