Dataset for protein BCL-2-like of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7AVA6_MCL1-01          ---------------------MFGLKRNAVIGLNLYCGGAGLGAGGGGAS
F6ZPD4_BCL2L10-01       -------------------------------------------AVAEALR
F7AVA6_MCL1-02          ---------------------MFGLKRNAVIGLNLYCGGAGLGAGGGGAS
F7CP56_BCL2A1-03        --------MTDCILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIR
F7CP56_BCL2A1-04        --MTDCEFGYIHMLAQDYLKYVL---------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --MTDCEFGYIHMLAQDYLKYVL---------------------------
A0A3Q2H0F6_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESE
A0A3Q2H0F6_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESE
A0A3Q2HRY3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPLGATPV
A0A3Q2HRY3_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPLGATPV
                                                                          

F7AVA6_MCL1-01          SPGGRLLAAGKEATARREGGGGEAGAVIGGSAGGSPQTTLAPDSLRVARP
F6ZPD4_BCL2L10-01       ERTALLL--------------------IDYLQRRAR--------------
F7AVA6_MCL1-02          SPGGRLLATGTKDTKPMGGSGAASRKALETLRRVGD--------------
F7CP56_BCL2A1-03        QNGGWVIAHSQYQ-------------------------------------
F7CP56_BCL2A1-04        ---------------QIPQPGSGPSKTSRVLQDIAF--------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        ---------------QIPQPGSGPSKTSRVLQDIAF--------------
A0A3Q2H0F6_BCL2L1-      METPSAINGNPSWHLADSPTGNGATGHSSSLDAREV--------------
A0A3Q2H0F6_BCL2L1-      METPSAINGNPSWHLADSPTGNGATGHSSSLDAREV--------------
A0A3Q2HRY3_BCL2-01      PGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALSP--------------
A0A3Q2HRY3_BCL2-02      PGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALSP--------------
                                                                          

F7AVA6_MCL1-01          SPIGAEGPDVTAPSSRLLFFAPTRCASPPEGMEAPAADAIMSPEEELDGY
F6ZPD4_BCL2L10-01       --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
                                                                          

F7AVA6_MCL1-01          EPEPLGKRPAVLPLLEFVREASSGPCTDGSLPSTPPPAEEEEDELYRQSL
F6ZPD4_BCL2L10-01       --------------------------------------------------
F7AVA6_MCL1-02          --------------------------------------------------
F7CP56_BCL2A1-03        --------------------------------------------------
F7CP56_BCL2A1-04        --------------------------------------------------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      --------------------------------------------------
A0A3Q2HRY3_BCL2-01      --------------------------------------------------
A0A3Q2HRY3_BCL2-02      --------------------------------------------------
                                                                          

F7AVA6_MCL1-01          EIISRYLREQATGTKDTKPMGGSGAASRKALETLRRVGDGVQRNHETAFQ
F6ZPD4_BCL2L10-01       ------------------------EPATPEVAVLRCVAAQIQPRNQRVLS
F7AVA6_MCL1-02          ------------------------GVQRNHETAFQGMLRKLDIKNE----
F7CP56_BCL2A1-03        --------------------------KSKRISIFLSMQDEIETEE-----
F7CP56_BCL2A1-04        ------------------------SVQNEVEKNLKPCLDNFHV-------
F7CP56_BCL2A1-02        --------------------------------------------------
F7CP56_BCL2A1-01        ------------------------SVQNEVEKNLKPCLDNFHV-------
A0A3Q2H0F6_BCL2L1-      ------------------------IPMAAVKQALREAGDEFELRYRRAFS
A0A3Q2H0F6_BCL2L1-      ------------------------IPMAAVKQALREAGDEFELRYRRAFS
A0A3Q2HRY3_BCL2-01      ------------------------VP-PVVHLTLRQAGDDFSRRYRRDFA
A0A3Q2HRY3_BCL2-02      ------------------------VP-PVVHLTLRQAGDDFSRRYRRDFA
                                                                          

F7AVA6_MCL1-01          GMLRKLDIKNEDDVKSLSRVMAHVFSD-GVTNWGRIVTLISF-GAFVAKH
F6ZPD4_BCL2L10-01       RYR----GFRGDHVGLAARMAQAIFGDRHVPSWGRVAALVTLAGTLLERA
F7AVA6_MCL1-02          -----------DDVKSLSRVMAHVFSD-GVTNWGRIVTLISF-GAFVAKH
F7CP56_BCL2A1-03        -------------------IIRDIFQQ-GKT-------------CFIPRY
F7CP56_BCL2A1-04        -------VSIDAARTIFNQVMEKQFED-GIINWGRIMTIFAFEGILIKKL
F7CP56_BCL2A1-02        --------------------MEKQFED-GIINWGRIMTIFAFEGILIKKL
F7CP56_BCL2A1-01        -------VSIDAARTIFNQVMEKQFED-GIINWGRIMTIFAFEGILIKKL
A0A3Q2H0F6_BCL2L1-      DLTSQLHITPGTAYQSFEQVVNELFRD-G-VNWGRIVAFFSFGGALCVES
A0A3Q2H0F6_BCL2L1-      DLTSQLHITPGTAYQSFEQVVNELFRD-G-VNWGRIVAFFSFGGALCVES
A0A3Q2HRY3_BCL2-01      EMSSQLHLTPFTARGRFATVVEELFRD-G-VNWGRIVAFFEFGGVMCVES
A0A3Q2HRY3_BCL2-02      EMSSQLHLTPFTARGRFATVVEELFRD-G-VNWGRIVAFFEFGGVMCVES
                                                * :                  :    

F7AVA6_MCL1-01          LKSINQESC-----------------IEPLAESITDVLVRTKRDWLVKQR
F6ZPD4_BCL2L10-01       PRGTYRKPKRGYKLELREWKAGVDRDWPRLVDFLCAWLKGRHRAWLEAHY
F7AVA6_MCL1-02          LKSINQESC-----------------IEPLAESITDVLVRTKRDWLVKQR
F7CP56_BCL2A1-03        QFNSNHMDM-----------------VK--LASPEEILSLPKTSWNIHQP
F7CP56_BCL2A1-04        LPERIAPDV---------------DTYKEISYFVAEFITKNTGEWIRQNG
F7CP56_BCL2A1-02        LPERIAPDV---------------DTYKEISYFVAEFITKNTGEWIRQNG
F7CP56_BCL2A1-01        LPERIAPDV---------------DTYKEISYFVAEFITKNTGEWIRQNG
A0A3Q2H0F6_BCL2L1-      VDKEMQVLV---------------S---RIATWMATYLNDHLEPWIQENG
A0A3Q2H0F6_BCL2L1-      VDKEMQVLV---------------S---RIATWMATYLNDHLEPWIQENG
A0A3Q2HRY3_BCL2-01      VNREMSPLV---------------D---NIALWMTEYLNRHLHTWIQDNG
A0A3Q2HRY3_BCL2-02      VNREMSPLV---------------D---NIALWMTEYLNRHLHTWIQDNG
                                                             :      *   : 

F7AVA6_MCL1-01          GW------------------------------------------------
F6ZPD4_BCL2L10-01       GW------------------------------------------------
F7AVA6_MCL1-02          GW------------------------------------------------
F7CP56_BCL2A1-03        GE------------------------------------------------
F7CP56_BCL2A1-04        GW------------------------------------ENGFVKKFEPKS
F7CP56_BCL2A1-02        GWVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNS
F7CP56_BCL2A1-01        GWVIAHSQYQKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNS
A0A3Q2H0F6_BCL2L1-      GW-------------------------KETALGTFCYFVSSLMRLSGQ--
A0A3Q2H0F6_BCL2L1-      GW-------------------------D------------TFVELYGN--
A0A3Q2HRY3_BCL2-01      GW-------------------------D------------AFVELYGP--
A0A3Q2HRY3_BCL2-02      GW-------------------------Q------------LCQAPTGSQE
                        *                                                 

F7AVA6_MCL1-01          -------------------------DGFVEFFHVEDLE-GGIRNVLLAFA
F6ZPD4_BCL2L10-01       -------------------------DGFCD----FSLTLPASQRILLVRF
F7AVA6_MCL1-02          -------------------------DGFVEFFHVEDLE-GGIRNVLLAFA
F7CP56_BCL2A1-03        -------------------------EEVRE----EALSTGGLDLILMPGL
F7CP56_BCL2A1-04        GWLTFLEVTGKMCEILFLKQYY----------------------------
F7CP56_BCL2A1-02        NHMDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGL
F7CP56_BCL2A1-01        NHMDMVKLASPEEILSLPKTSWNIHQPGEEEVREEALSTAAWR-------
A0A3Q2H0F6_BCL2L1-      -----------GGALQLAPSYSAFWADSRAPLGTR--------GFSLALQ
A0A3Q2H0F6_BCL2L1-      -----------NAAAESRKGQERFNRWFLTGMTVA--------GVVLLGS
A0A3Q2HRY3_BCL2-01      ---------SMRPLFDF------SWLSLKALLSLALVG-----ACITLGA
A0A3Q2HRY3_BCL2-02      MFSGGWTIHSGSPLQNLCVSRAGNWFSEKKNMTWCLTSDKDVIDRTPIRM
                                                                          

F7AVA6_MCL1-01          GVAGVGAGLAYLIR------------------------------------
F6ZPD4_BCL2L10-01       LLSCFSASV-----------------------------------------
F7AVA6_MCL1-02          GVAGVGAGL--------AYLIR----------------------------
F7CP56_BCL2A1-03        GFDKHGNRLGRGKGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDE
F7CP56_BCL2A1-04        --------------------------------------------------
F7CP56_BCL2A1-02        GFDKHGNRLGRGKGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDE
F7CP56_BCL2A1-01        --------------------------------------------------
A0A3Q2H0F6_BCL2L1-      EMPLQ---------------------------------------------
A0A3Q2H0F6_BCL2L1-      LFSRK---------------------------------------------
A0A3Q2HRY3_BCL2-01      YLGHK---------------------------------------------
A0A3Q2HRY3_BCL2-02      YQGRKSREAEIQSQCRPPCMLLHLLEIQVPVLFLSE--------------
                                                                          

F7AVA6_MCL1-01          ----------------
F6ZPD4_BCL2L10-01       -------LIYLWTKLS
F7AVA6_MCL1-02          ----------------
F7CP56_BCL2A1-03        NDMKVDEVLYEDSSAS
F7CP56_BCL2A1-04        ----------------
F7CP56_BCL2A1-02        NDMKVDEVLYEDSSAS
F7CP56_BCL2A1-01        ----------------
A0A3Q2H0F6_BCL2L1-      ----------------
A0A3Q2H0F6_BCL2L1-      ----------------
A0A3Q2HRY3_BCL2-01      ----------------
A0A3Q2HRY3_BCL2-02      ----------------
                                        

© 1998-2020Legal notice