Dataset for protein Bcl-xL of organism Dromaius novaehollandiae

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSSSNRELVIDFVSYKLSQKDYSWSQLEEEDENRTDFAVEAGMAGVLNGSPSWHPPASHVVNGAAVHRSSLEVHETVQAA
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DVRQALREAGDEFELRYQRAFSDLTSQLHITPATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVEKEMRVLVG
                                                                                

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
************************  :              *  .:: : *  : .:. : :*      
RIVSWMTTYLTDHLDPWIQENGGWrrm--------------GqetwnvylLtmstvssvlllGs-----
                        ecfvdlygnnaaaeirk lcpfekwg qgaefagcfcf illsrk
© 1998-2022Legal notice