Dataset for protein Bcl-xL of organism Dromaius novaehollandiae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4JDK2_BCL2L1-      MSSSNRELVIDFVSYKLSQKDYSWSQLEEEDENRTDFAVEAGMAGVLNGS
A0A8C4JDK2_BCL2L1-      MSSSNRELVIDFVSYKLSQKDYSWSQLEEEDENRTDFAVEAGMAGVLNGS
                        **************************************************

A0A8C4JDK2_BCL2L1-      PSWHPPASHVVNGAAVHRSSLEVHETVQAADVRQALREAGDEFELRYQRA
A0A8C4JDK2_BCL2L1-      PSWHPPASHVVNGAAVHRSSLEVHETVQAADVRQALREAGDEFELRYQRA
                        **************************************************

A0A8C4JDK2_BCL2L1-      FSDLTSQLHITPATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
A0A8C4JDK2_BCL2L1-      FSDLTSQLHITPATAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVES
                        **************************************************

A0A8C4JDK2_BCL2L1-      VEKEMRVLVGRIVSWMTTYLTDHLDPWIQENGGWRCM-------------
A0A8C4JDK2_BCL2L1-      VEKEMRVLVGRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAEIR
                        **********************************  :             

A0A8C4JDK2_BCL2L1-      -GLCPWEVYGLQMSEFSSCFCFGI-----
A0A8C4JDK2_BCL2L1-      KGQETFNKWLLTGATVAGVLLLGSLLSRK
                         *  .:: : *  : .:. : :*      

© 1998-2022Legal notice