Dataset for protein Mcl-1 of organism Dicentrarchus labrax

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MNIIQTNRAAYSLTNGNMSVFLTQNGGVDGHMHYGPGDSSPQIAMGSSLASHNGSVGSSDAPKRPKNLGVSPTNGYLTKA
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
IRGVSDDVEDGSLPCTPELLSDTEIDVSGCPAGDEVLNSETTQLIDCFLRDFTGLSKSRWNESKALATMKRVVDGVLEKH
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RYAYNGMIRKLSLDEREDDASFVGAVAKSLFADGTTNWGRVASLVAFGAVVSQYLTEKGRGNCVELVGQEISSYLLTHQR
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************** . *                             
DWLVKNNSWDGFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIRssrL-----------------------------
                                               rpp srvtgqttlievlggngveplhgddpqqt

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *..   : :::** *.    ..  *..  .: *   :* .::       :.   *:.*  .::. *
--------------LvtrnqmrvqqRLlHt----gslrLrsssrswCttskCtsts-------kssllCtvLgpnmqsyL
slcpllwlmmlatt fppalfilkn  h nkrsaaeae hqflqav iihe igsayivklglenrkh st flglegt 

         
....:....
         
gt-------
elgdfkqih
© 1998-2023Legal notice