Dataset for protein Mcl-1 of organism Dicentrarchus labrax

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8P4G790_MCL1-01      MNIIQTNRAAYSLTNGNMSVFLTQNGGVDGHMHYGPGDSSPQIAMGSSLA
A0A8P4G790_MCL1-02      MNIIQTNRAAYSLTNGNMSVFLTQNGGVDGHMHYGPGDSSPQIAMGSSLA
                        **************************************************

A0A8P4G790_MCL1-01      SHNGSVGSSDAPKRPKNLGVSPTNGYLTKAIRGVSDDVEDGSLPCTPELL
A0A8P4G790_MCL1-02      SHNGSVGSSDAPKRPKNLGVSPTNGYLTKAIRGVSDDVEDGSLPCTPELL
                        **************************************************

A0A8P4G790_MCL1-01      SDTEIDVSGCPAGDEVLNSETTQLIDCFLRDFTGLSKSRWNESKALATMK
A0A8P4G790_MCL1-02      SDTEIDVSGCPAGDEVLNSETTQLIDCFLRDFTGLSKSRWNESKALATMK
                        **************************************************

A0A8P4G790_MCL1-01      RVVDGVLEKHRYAYNGMIRKLSLDEREDDASFVGAVAKSLFADGTTNWGR
A0A8P4G790_MCL1-02      RVVDGVLEKHRYAYNGMIRKLSLDEREDDASFVGAVAKSLFADGTTNWGR
                        **************************************************

A0A8P4G790_MCL1-01      VASLVAFGAVVSQYLTEKGRGNCVELVGQEISSYLLTHQRDWLVKNNSWD
A0A8P4G790_MCL1-02      VASLVAFGAVVSQYLTEKGRGNCVELVGQEISSYLLTHQRDWLVKNNSWD
                        **************************************************

A0A8P4G790_MCL1-01      GFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIRRPRL---------
A0A8P4G790_MCL1-02      GFVEFFRVADPESTVRNTLMAFAGFAGIGATLALLIRSSPLSRVTGQTTL
                        ************************************* . *         

A0A8P4G790_MCL1-01      ----------------------------------LFPRNLMRLQQRLHHT
A0A8P4G790_MCL1-02      IEVLGGNGVEPLHGDDPQQTSLCPLLWLMMLATTLVTPAQFIVKNRLLHN
                                                          *..   : :::** *.

A0A8P4G790_MCL1-01      KRSAASAELHSSLQSWCITSECTSTSYIVKLGLKSSKLCTTLFPGLEGYL
A0A8P4G790_MCL1-02      ----GELRLRQFSRAVCTIHKCIGSA-------ENRLHCSVLGLNMQSTL
                            ..  *..  .: *   :* .::       :.   *:.*  .::. *

A0A8P4G790_MCL1-01      ETGDFKQIH
A0A8P4G790_MCL1-02      GL-------
                                 

© 1998-2023Legal notice